DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and Y18D10A.22

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001021723.1 Gene:Y18D10A.22 WormBaseID:WBGene00014864 Length:333 Species:Caenorhabditis elegans

Alignment Length:205 Identity:65/206 (32%)
Similarity:122/206 (59%) Gaps:3/206 (1%)


  Fly    15 SVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKFSHLLHKVLREGH 79
            :|.||:...|||||.||:|:||:..||||.::.||.::....|.:.....|||.:|:||:|:|||
 Worm    12 AVRKAITEDEAPLKPKHSRTIIVGTHKAKSSEMFWNLLESIQLEKHPVMTWKFCNLVHKLLQEGH 76

  Fly    80 ESAIRHSQSHKKMILEVGKMWGLLQDDIGCCIQAYSKLLATKLNFHDKNRMFPGTLNISFTELFI 144
            .:..:.:..|.....::...| :.:...|.|||||.:||..::.||.|:..|||.|:::.:::.|
 Worm    77 STVPQETYRHLNRFKQLAHYW-IHRGSYGPCIQAYCQLLHDRVTFHHKHPFFPGNLDLTNSQMQI 140

  Fly   145 AVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPIVCLIQDSNALYD 209
             :..::....::..::...::.::.||..::..:...|.:|:.|| :|.|.|::.:||:::.:.:
 Worm   141 -LQGNVVKMLEITSDLMSQMDLLLVLQERVYEMINTRRWNSLIPQ-ECMLLPLISVIQETSKILN 203

  Fly   210 LSVRLMFKLH 219
            ..|.:|||||
 Worm   204 YIVHIMFKLH 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 65/206 (32%)
TMPIT 402..>504 CDD:285135
I_LWEQ 973..1120 CDD:279885
Y18D10A.22NP_001021723.1 VHS_ENTH_ANTH 6..>213 CDD:295355 64/204 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32700532
eggNOG 1 0.900 E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T374819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10407
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1344
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.