DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and end4

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_594069.2 Gene:end4 PomBaseID:SPAC688.11 Length:1102 Species:Schizosaccharomyces pombe

Alignment Length:1253 Identity:291/1254 (23%)
Similarity:519/1254 (41%) Gaps:309/1254 (25%)


  Fly    12 LNVSVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKFSHLLHKVLR 76
            |..||.||.:..|...|.||.||.||.......|:.||..|..|||:.:....:|....:|:||:
pombe    17 LMTSVRKATSIDETAPKRKHVRSCIIFTWDHHTARPFWTAIKVQPLLANEVQTFKALITIHRVLQ 81

  Fly    77 EGHESAIRHSQSHKKMILEVGKMW----------GLLQDDIGCCIQAYSKLLATKLNFHDKNRMF 131
            |||:||:..|||.|..:....:.:          .|::|        |...|..||:||.::..|
pombe    82 EGHKSALVDSQSEKGWLKTCERQYDGESSPKGYSDLIRD--------YVDYLLDKLSFHAQHPEF 138

  Fly   132 PGTLN----ISFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQC 192
            .||..    ||..:    || |.|..::...::.:..:.|...|..:||:.::      :.:.:|
pombe   139 NGTFEYKEYISLRQ----VD-DPNEGYETVYDMMNLQDHIDEFQKQLFSNFKR------SNKNEC 192

  Fly   193 RLAPIVCLIQDSNALYDLSVRLMFKLHDGVPY-DVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKD 256
            |:|.:|.|:|:|..:|.....::..|:..|.. :.:...:.|:.....:|:.||.:...|:|...
pombe   193 RIAALVPLVQESYGIYRFLTSMLRALYSTVDAPETLEPLKHRYKSQHHRLRQFYADCSNLRYLTS 257

  Fly   257 LITIPELPDSSPNFKSQNDF--------------------------TSYVPPV-VHVP------- 287
            ||::|.||...|:.:..::.                          ||..||| ::.|       
pombe   258 LISVPRLPHDPPDLEGDDNIPDLPKRPASIAPQPTGASTIAPQPTGTSPSPPVEMNFPDTSDITP 322

  Fly   288 --QEPDPVVEDLVDTNNHELEAFSQAQQQLSMLEGIISEKEASIEELSF---KLDAMQKNFDALQ 347
              .||:|:.:...|....:..|..||.||.:..:..::.::|:.::...   :...|::...|.|
pombe   323 AYSEPEPIQDFWSDPTLDQQLAAQQAAQQAAQQQAELAAQQAAAQQAQLAAQQAAEMERQRMAAQ 387

  Fly   348 QSYRHDVQELQQNNTVLSNDLVLAREMCA--TFRMQND----DLEMQLNQNPILLQKAMEEEEKH 406
            |   |. |.|:......:....:|:|..|  .|:||..    :||.||                 
pombe   388 Q---HQ-QALEAIQMAQAEQQRIAQEQLAQQQFQMQTQGQLAELEQQL----------------- 431

  Fly   407 KLSSEKFNKLKTLYTKIRDEHIQLLREQSDCNKSLNKEKQVNSQLLLETKELTNEISKIKVNVEE 471
                        |.|:.:.|...:|..|.|.                ..:.|.||:|:..||   
pombe   432 ------------LATRGQLEQSNVLLNQYDA----------------RVRTLENELSQAGVN--- 465

  Fly   472 KEKTNLILQKQIEEHKEKIAHLEAVKNEM---KEKFDDVVK---QKEIQELDIISTSENLRLNCL 530
                   ||:||.::.:.|   |::||::   |.|::.:.|   |...:.||::|..:.::|...
pombe   466 -------LQEQIHQNDDLI---ESLKNQILTWKNKYEALAKLYTQLRQEHLDLLSKYKQIQLKAS 520

  Fly   531 KVEELNGNLNDTLEKLSNAESQINAKTEDIEKML-------------------KAFEAEKALLLT 576
            ..:|       .::|....|.::..|..::..|:                   |....|:.|.|.
pombe   521 SAQE-------AIDKKEKMEREMKNKNLELADMILERDRARHELETMHRSQRDKQESTERELRLL 578

  Fly   577 QIEQQSVESKSHSEAQ------NAQLQEIMDNLEQKDKEFNEVKLQLSSAESQISLKALEIQNNL 635
            |.:..|:|....||..      |.::..:.|.|..||:|...:.::|.|.|::.           
pombe   579 QEKAASLERNKSSEVSNLLSRYNTEVAHLEDALHSKDRELANLGVELKSTENRY----------- 632

  Fly   636 KAFEAEKSVLLTKIEQLGIEHK--NNSEAQNAQLQLTLNNLEQNESALQQTQEIVNQLRQENASA 698
                  :.:|..|.|:|.|:..  :.|..|.::|||..|:::|                   |..
pombe   633 ------RQLLQEKEEELEIQKAAVDESLLQLSKLQLDRNDIDQ-------------------AMD 672

  Fly   699 GQRNEDLQSKL----SLTEVKLTQATQQIDAVTSSYQICSTDLSELRKLVIKTVKEICNSKLSGS 759
            .|.:|.|:|:|    .:.:..|....|::|  ||.|::                    :|.:...
pombe   673 TQIDELLKSQLEKLDDIVDSVLATGIQRLD--TSLYEL--------------------DSPMHAG 715

  Fly   760 EQQPLDAVPNIIREMETILNKFNNASAI-----NYVAS------TEGLQNVMYLGYVFIKLYDQC 813
            .|.   |.|..|  :.||.|..|||:..     ||.|.      :|.:..|........::.:..
pombe   716 NQY---ATPEFI--LSTIENASNNATDFSTAFNNYFADGPNADHSEVINGVNLFSTAIYEVANNA 775

  Fly   814 DVIYKTTTAIETGQE-------------------IFS----------KTNLLCTDICQLFQYLLN 849
            ..:.: ||..:.|.:                   :||          ||:|:..:..:|.:||  
pombe   776 KGLSR-TTGDDQGSDRFVGLSRDLVNMAKRFLSSLFSVNTRKMDVNVKTDLVIGENIELQRYL-- 837

  Fly   850 NETKEPERQKTITDIQTKL--RDIEKLIEKIKASFEQKIDLDKLLEIELREMDAAIDDAASKITD 912
                     :.:|....|.  ::.|..:..:.|..|   ::::|::.:|.|...||..|..::.:
pombe   838 ---------QQLTQYSEKFLNKESENTVGLLNAPGE---NIEELVDNQLAETAQAIQQAILRLQN 890

  Fly   913 LLAKAREKD-NQTNLEVNGKIVDACTTLMECVKALIQKSRLLQHEIVASQKGNASANEFYRRNSQ 976
            :.||.::.. :.:.|:|:..::.|...:.|.:..||:.:...|.||||..:|::|...||:::::
pombe   891 IAAKPKDDSLSPSELQVHDSLLSASIAITEAIARLIKAATASQAEIVAQGRGSSSRGAFYKKHNR 955

  Fly   977 WSDGLISASKSVAKAANYLVEAANKAIESESGKNFE-LIVAAQEIAACTTQMVIASKVKAERNSQ 1040
            |::|||||:|:||:|...|:|.|:..:...|  :|| ||||...::|.|.|:|.||:|||...|:
pombe   956 WTEGLISAAKAVARATTTLIETADGVVNGTS--SFEHLIVACNGVSAATAQLVAASRVKANFASK 1018

  Fly  1041 KLTDLTKASRSVTQATGTLVATVKDCNSQLEQQSEIELSKLTPSQIKTMEMEIHVKVLEIEQALQ 1105
            ....|..|:::||:|...||..|:....:.::....:.|.|...:.:..|:|..|::|::|..|.
pombe  1019 VQDHLEDAAKAVTEACKALVRQVESVALKAKEVQHEDFSSLGVHEYRRKEIEQQVQILKLENDLV 1083

  Fly  1106 MQRLKLSSFRKEHYKNAD 1123
            ..|.:|...||..|..|:
pombe  1084 AARRRLFDMRKTSYHVAE 1101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 78/310 (25%)
TMPIT 402..>504 CDD:285135 22/105 (21%)
I_LWEQ 973..1120 CDD:279885 51/148 (34%)
end4NP_594069.2 ANTH 14..281 CDD:284961 76/283 (27%)
GAS 468..621 CDD:290562 34/163 (21%)
ILWEQ 902..1100 CDD:214607 66/200 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I833
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T1124841
orthoMCL 1 0.900 OOG5_129034
Panther 1 1.100 LDO PTHR10407
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1344
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.