DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hip1 and Hip1

DIOPT Version :8

Sequence 1:NP_648597.2 Gene:Hip1 / 39450 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_666113.2 Gene:Hip1 / 215114 MGIID:1099804 Length:1029 Species:Mus musculus

Alignment Length:1151 Identity:347/1152 (30%)
Similarity:565/1152 (49%) Gaps:210/1152 (18%)


  Fly     5 AEKEFYH--LNVSVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKF 67
            ||:|.:.  ..|||:||:|..|..:|.||||:.|:..|..|.|:|||.:::|.||..:....|||
Mouse    31 AERESFERTQTVSVNKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAMLCWKF 95

  Fly    68 SHLLHKVLREGHESAIRHSQSHKKMILEVGKMWGLLQDDIGCCIQAYSKLLATKLNFHDKNRMFP 132
            .|:.||:||:||.:.::.|..:|..:.::.:|||.|.:..|.....|.|||.|::.:|.||..||
Mouse    96 CHVFHKLLRDGHPNVLKDSLRYKNELSDMSRMWGHLSEGYGQLCSIYLKLLRTRMEYHTKNPRFP 160

  Fly   133 GTLNISFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPI 197
            |.|.:|..:|..|.:.|:|..|||.||:|||||..:.|..|:|:|::..|..|:|..|||||||:
Mouse   161 GNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQTVFNSLDMSRSVSVTTAGQCRLAPL 225

  Fly   198 VCLIQDSNALYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPE 262
            :.:|.|.:.|||.:|:|:||||..:|.|.:.||||||...|.|||..:.....|||||.||.||:
Mouse   226 IQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFQRSSNLQYFKRLIQIPQ 290

  Fly   263 LPDSSPNFKSQNDFTSYVPPVVHVPQE---PD--PVVE--DLVDTNNHELEAF------------ 308
            ||::.|||...:..:.::.|||.:|.|   ||  ||:|  ||:|.:..:...|            
Mouse   291 LPENPPNFLRASALSEHISPVVVIPAEVSSPDSEPVLEKDDLMDMDASQQTLFDNKFDDVFGSSL 355

  Fly   309 SQAQQQLSMLEGI-ISEKEASIEELSFKLDAMQKNFDALQQSYRHDVQELQQNNTVLSNDLV--- 369
            |......:...|: ..||:..||.|..::..:....|.::...:..:.:|:...:.|..:|.   
Mouse   356 SSDPFNFNNQNGVNKDEKDHLIERLYREISGLTGQLDNMKIESQRAMLQLKGRVSELEAELAEQQ 420

  Fly   370 -LAREM---CATFRMQNDDLEMQLNQNPILLQKAMEEEEKHKLSSEKFNKLKTLYTKIRDEHIQL 430
             |.|:.   |...|.:.|:|:.|........:...|.|.|.:.:.::::|||..|:::...|..|
Mouse   421 HLGRQAMDDCEFLRTELDELKRQREDTEKAQRSLTEIERKAQANEQRYSKLKEKYSELVQNHADL 485

  Fly   431 LREQSDCNKSLNKEKQVNSQLLLETKELTNEISKIKVNVEEKEKTNLILQKQIEEHKEKIAHLEA 495
            ||:.::..|.::..:|....|..|.|||.:..::    .:|::..                 ||.
Mouse   486 LRKNAEVTKQVSVARQAQVDLEREKKELADSFAR----TQEQQDV-----------------LEN 529

  Fly   496 VKNEMKEKFDDVVKQKEIQELDIISTSENLRLNCLKVEELNGNLNDTLEKLSNAESQINAKTEDI 560
            :|:|:      ...::|:|.|.                             ||.|:  :|::|  
Mouse   530 LKHEL------ATSRQELQVLH-----------------------------SNLET--SAQSE-- 555

  Fly   561 EKMLKAFEAEKALLLTQIEQQSVESKSHSEAQNAQLQEIMDNLEQKDKEFNEVKLQLSSAESQIS 625
                       |..||||.:  :|.:..|.|..|         .|:::|.:.::.||.|  :||.
Mouse   556 -----------AKWLTQIAE--LEKEQGSLATVA---------AQREEELSALRDQLES--TQIK 596

  Fly   626 LKALEIQNNLKAFEAEKSVLLTKIEQLGIEHKNNSEAQNAQLQLTLNNLEQNESALQQTQEIVNQ 690
            |...: ::..:..:.::..||..|                           .::|.::.||.::|
Mouse   597 LAGAQ-ESMCQQVKDQRKTLLAGI---------------------------RKAAEREIQEALSQ 633

  Fly   691 LRQEN-ASAGQRNEDLQSKLSLTEVKLTQATQQIDAVTSSYQICSTDLSELRKLVIKTVKEICNS 754
            |.:.. .|.....:.|.||:|    .::...:|::...|.|..|..|:|||    :.::..:.: 
Mouse   634 LEEPTLISCAGSTDHLLSKVS----SVSSCLEQLEKNGSQYLACPEDISEL----LHSITLLAH- 689

  Fly   755 KLSGSEQQPLDAVPNIIREMETILNKFNNASAINYVASTEGLQNVMYLGYVFIKLYDQCDVIYKT 819
             |:|                :||:    ..||.:..|..|...::                   |
Mouse   690 -LTG----------------DTII----QGSATSLRAPPEPADSL-------------------T 714

  Fly   820 TTAIETGQEIFSKTNLLCTDICQLFQYLLNNETKEPERQKTITDIQTKLRDIEKLIEKI---KAS 881
            ....:.|:|..:              ||.:.|.:.......:|.::..|..::.|.|::   ...
Mouse   715 EACRQYGRETLA--------------YLSSLEEEGTMENADVTALRNCLSRVKTLGEELLPRGLD 765

  Fly   882 FEQKIDLDKLLEIELREMDAAIDDAASKITDLLAKAREKDNQTNLEVNGKIVDACTTLMECVKAL 946
            .:|: :|..|::.|:....|||:.|.::|.::|:|:|..|....||||.:|:.:||:||:.:|.|
Mouse   766 IKQE-ELGDLVDKEMAATSAAIEAATTRIEEILSKSRAGDTGVKLEVNERILGSCTSLMQAIKVL 829

  Fly   947 IQKSRLLQHEIVASQKGNASANEFYRRNSQWSDGLISASKSVAKAANYLVEAANKAIESESGKNF 1011
            :..|:.||.|||.|.:|.||..|||.:||:|::|||||||:|...|..:|:||:..::.: ||..
Mouse   830 VVASKDLQKEIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATIMVDAADLVVQGK-GKFE 893

  Fly  1012 ELIVAAQEIAACTTQMVIASKVKAERNSQKLTDLTKASRSVTQATGTLVATVKDCNSQLEQQSEI 1076
            ||:|.::||||.|.|:|.||||||.:.|..||.|.:|||.|.|||..:||:.....||:|:...:
Mouse   894 ELMVCSREIAASTAQLVAASKVKANKGSLNLTQLQQASRGVNQATAAVVASTISGKSQIEETDSM 958

  Fly  1077 ELSKLTPSQIKTMEMEIHVKVLEIEQALQMQRLKLSSFRKEHYKNA 1122
            :.|.:|.:|||..||:..|:|||:|..||.:|.||...||:||:.|
Mouse   959 DFSSMTLTQIKRQEMDSQVRVLELENDLQKERQKLGELRKKHYELA 1004

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 117/274 (43%)
TMPIT 402..>504 CDD:285135 22/102 (22%)
I_LWEQ 973..1120 CDD:279885 70/147 (48%)
Hip1NP_666113.2 ANTH 37..308 CDD:284961 117/273 (43%)
DUF4391 <336..441 CDD:291033 20/113 (18%)
pDED 410..491 20/81 (25%)
TACC 445..610 CDD:282818 30/165 (18%)
HIP1_clath_bdg 482..572 CDD:293123 11/90 (12%)
ILWEQ 806..1004 CDD:214607 54/201 (27%)
Important for actin binding. {ECO:0000250} 859..916 9/60 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32717303
eggNOG 1 0.900 E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 427 1.000 Inparanoid score I1721
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T616197
orthoMCL 1 0.900 OOG5_129034
Panther 1 1.100 LDO PTHR10407
Phylome 1 0.910 0.759 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1344
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.