DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and tag-138

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_493260.1 Gene:tag-138 WormBaseID:WBGene00006484 Length:362 Species:Caenorhabditis elegans

Alignment Length:364 Identity:105/365 (29%)
Similarity:168/365 (46%) Gaps:58/365 (16%)


  Fly    15 SVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKFSHLLHKVLREGH 79
            :|.||:...|.|||.||..:|::..|..|.:..||..:.:..|.......|||..|:||:||:||
 Worm    13 AVQKAITKDETPLKPKHLETILLGTHTEKSSAIFWSSVKKIKLENHPVLTWKFCLLVHKLLRDGH 77

  Fly    80 ESAIRHSQSHKKMILEVGKMWGLLQD--DIGCCIQAYSKLLATKLNFHDKNRMFPGTLNISFTEL 142
            ....:.:..::|...::...|   :|  |.|.||.||.|||..::.||.|...|||.|.:|..:|
 Worm    78 PVVPKEAYRNEKRFTQLALHW---KDKRDYGPCIDAYCKLLHDRVIFHHKRPYFPGNLFVSPLQL 139

  Fly   143 FIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIF-SSMEKYRMSSMTPQGQCRLAPIVCLIQDSNA 206
             ..:.|||:...:|..::...::.::|.|..:: .|....|....||||||.:.|::.:|.|:..
 Worm   140 -DTMGRDLSRMLRLTGDMMHQMDSLLAFQEKVYLLSNSSPRWDPNTPQGQCLMLPLISVIMDTWP 203

  Fly   207 LYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPELPDSSPNFK 271
            .:...||:|:.||..|....:.|:|.||..:|.|.|.||......|||:..:.||..|..:|||.
 Worm   204 FFIYIVRMMYNLHSNVSPHELEGYRSRFQTIFEKTKQFYEECSKHQYFRCFVQIPTFPLHAPNFF 268

  Fly   272 SQNDFTSY--------------VPPV---------------------VHVPQEPDPVVEDLVDTN 301
            :|:|..||              |.|.                     .||.:|        .|.|
 Worm   269 TQSDLESYQTYLIGESKKLTETVTPAEEARTRIEHYENRLKEMHGEFQHVRRE--------ADEN 325

  Fly   302 NHELEAFSQAQQQLSMLEGIISEKEASI-----EELSFK 335
            ..|::   :.:.:|::.:...::.:|:|     :|.|.|
 Worm   326 REEVQ---RLRYELALRDASRTQNQAAIYDTPPDEFSIK 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 92/283 (33%)
TMPIT 402..>504 CDD:285135
I_LWEQ 973..1120 CDD:279885
tag-138NP_493260.1 ANTH 7..278 CDD:284961 91/269 (34%)
GrpE <295..>333 CDD:295646 6/49 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32700567
eggNOG 1 0.900 E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T374819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10407
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1344
TreeFam 1 0.960
98.840

Return to query results.
Submit another query.