DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and hipr-1

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_741253.1 Gene:hipr-1 WormBaseID:WBGene00022717 Length:927 Species:Caenorhabditis elegans

Alignment Length:1152 Identity:334/1153 (29%)
Similarity:508/1153 (44%) Gaps:299/1153 (26%)


  Fly    15 SVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKFSHLLHKVLREGH 79
            :|.||:...|.|||.||||:||:..||.|.:..||..:.|..|.:.....|||.||:||:||:||
 Worm    18 AVQKAITKNEVPLKPKHARTIIVGTHKEKSSGIFWHTVGRIQLEKHPVLTWKFCHLVHKLLRDGH 82

  Fly    80 ESAIRHSQSHKKMILEVGKMWGLLQ-DDIGCCIQAYSKLLATKLNFHDKNRMFPGTLNISFTELF 143
            ......:..:.....::.:.|..|. ...|.||::|.|||..::.||:|..:.||.|:::.::| 
 Worm    83 RKVPEETYRYVNRFTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYPVVPGKLDLNDSQL- 146

  Fly   144 IAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPIVCLIQDSNALY 208
            ..::.||:..|::.:::.|.::.::.||..::..|...|.:|:.|||||.|:|::..|.|::..|
 Worm   147 KTLEGDLDNMFEMTIDMLDQMDALLVLQDRVYEMMNSLRWNSLIPQGQCMLSPLIIAILDTSKFY 211

  Fly   209 DLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPELPDSSPNFKSQ 273
            |..|:::||||..||.|.:.|||.||..:|.:.|.||.....|||||.|::||.||..:|||..|
 Worm   212 DYLVKMIFKLHSQVPPDALEGHRSRFRTIFERTKKFYEESSNLQYFKYLVSIPTLPSHAPNFLQQ 276

  Fly   274 NDFTSYVPPVVHVPQEPDPVVEDLVDTNNHELEAFSQA----------------QQQLSML---- 318
            :|..||..|..::..|..   ||....|.|:.|..:.|                ::|:.||    
 Worm   277 SDLESYRTPHAYLHSEGS---EDGTSLNGHDGELLNLAEAEPQQASPSSQPDPREEQIVMLSRAV 338

  Fly   319 -------EGIISEKEASIEELSFKLDAMQKNFDALQQSYRHDVQELQQNNTVLSNDLVLAREMCA 376
                   |.:|.|..:.||:...:|..||..||..::....:.:|.|:    |.|:|.| |:   
 Worm   339 EDEKFAKERLIQEARSRIEQYENRLLQMQGEFDHAKREADENREEAQR----LKNELAL-RD--- 395

  Fly   377 TFRMQNDDLEMQLNQNPILLQKAMEEEEKHKLSSEKFNKLKTLYTKIRDEHIQLLREQSDCNKSL 441
            ..|.|.||..::            |.|.|...:.|:|||:|.:|.|.|.||:..|.:..|     
 Worm   396 ASRTQTDDARVK------------EAELKATAAEERFNKMKGVYEKFRSEHVLALTKLGD----- 443

  Fly   442 NKEKQVNSQLLLETKELTNEISKIKVNVEEKEKTNLILQKQIEEHKEKIAHLEAVKNEMKEKFDD 506
                                                 :|||:|..:             |.||| 
 Worm   444 -------------------------------------IQKQLEASE-------------KSKFD- 457

  Fly   507 VVKQKEIQELDIISTSENLRLNCLKVEELNGNLNDTLEKLSNAESQINAKTEDIEKMLKAFEAEK 571
              |.:||..|:            .||||........|.|   ||....|..|             
 Worm   458 --KDEEITALN------------RKVEEAQREAGRALTK---AEGDAGAVDE------------- 492

  Fly   572 ALLLTQIEQQSVESKSHSEAQNAQLQEIMDNLEQKDKEFNEVKLQLSSAE--SQISLKALEIQNN 634
              :.||:.:..:|.:        :|:..:|:|    :|.:..:|..||||  ::|.|..||:.. 
 Worm   493 --MRTQLVKADIEVE--------ELKRTIDHL----RESHANQLVQSSAEETNKIRLAELEVAK- 542

  Fly   635 LKAFEAEKSVLLTKIEQLGIEHKNNSEAQNAQ--------LQLTLNNLEQNESALQQTQEIVNQL 691
                  |..|.:|::    .:|..:: .|||.        .|..:|||             ||.|
 Worm   543 ------ESGVGITQM----FDHCEDA-LQNATSITYPPHLAQSAMNNL-------------VNIL 583

  Fly   692 RQENASAGQRNEDLQSKLSLTEVKLTQATQQIDAVTSSYQICSTDLSELRKLVIKTVKEICNSKL 756
            ..|     :.:|.|.:|               |.|.:.: :.||.||.                 
 Worm   584 SNE-----RLDEPLATK---------------DNVFAGH-LLSTTLSA----------------- 610

  Fly   757 SGSEQQPLDAVPNIIREMETILNKFNNASAINYVASTEGLQNVMYLGYVFIKLYDQCDVIYKTTT 821
                                       |::..|.||.|..:.|          .|||..:     
 Worm   611 ---------------------------AASAAYTASIESYEGV----------NDQCKKV----- 633

  Fly   822 AIETGQEIFSKTNLLCTDICQLFQYLLNNETKEPERQKTI-TDIQTKLRDIEKLIEKIKASFEQK 885
             :...:..||..:.|                ...::.|.: .||||        :..:..|...:
 Worm   634 -LAAAKVAFSDDSAL----------------SRADKMKLLRQDIQT--------LNSLMISLPLQ 673

  Fly   886 IDLDK-----LLEIELREMDAAIDDAASKITDLLAKAREKDNQTNLEVNGKIVDACTTLMECVKA 945
            .|:||     .||.|:|.||.||..|..:|..:..:|||..:...||||..|:..|..||..:..
 Worm   674 TDIDKDVVGNELEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIRLEVNESILANCQALMSVIMQ 738

  Fly   946 LIQKSRLLQHEIVASQKGNASANEFYRRNSQWSDGLISASKSVAKAANYLVEAANKAIESESGKN 1010
            |:..||.||.||||:.|...|..|||:||.||::||:||:|:|..||..|||:|:..:..: ||.
 Worm   739 LVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVVTGK-GKF 802

  Fly  1011 FELIVAAQEIAACTTQMVIASKVKAERNSQKLTDLTKASRSVTQATGTLVATVKDCNSQLEQQSE 1075
            ..||||||||||.|.|:.::|:|||:::|.||..|:.|:::|.|.|..:||.||:..:.|..:..
 Worm   803 EHLIVAAQEIAASTAQLFVSSRVKADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGS 867

  Fly  1076 IELSKLTPSQIKTMEMEIHVKVLEIEQALQMQRLKLSSFRKEHYKNA 1122
            ::.|.|:....|..|||..||:||:||:|..:|.||::.||:||..|
 Worm   868 LDFSYLSLHAAKKEEMESQVKMLELEQSLNQERAKLAALRKQHYHMA 914

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 101/267 (38%)
TMPIT 402..>504 CDD:285135 20/102 (20%)
I_LWEQ 973..1120 CDD:279885 67/147 (46%)
hipr-1NP_741253.1 ANTH 13..284 CDD:284961 101/267 (38%)
TPP_enzymes <680..718 CDD:294952 13/38 (34%)
ILWEQ 716..914 CDD:214607 89/199 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32700494
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T374819
orthoMCL 1 0.900 OOG5_129034
Panther 1 1.100 LDO PTHR10407
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1344
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.