DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and C16C8.16

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_494544.2 Gene:C16C8.16 WormBaseID:WBGene00015853 Length:267 Species:Caenorhabditis elegans

Alignment Length:272 Identity:61/273 (22%)
Similarity:119/273 (44%) Gaps:56/273 (21%)


  Fly   412 KFNKLKTLYTKIRDEHIQ-----LLREQSDCNKSL-------NKE-KQVNSQLLLETKELTNEI- 462
            ||.||:...:||::|..:     |.:|..|.::.|       |.| ||:...::.|.|.:..|: 
 Worm    10 KFQKLRVEASKIQNEFKEKPSYTLFKETLDISEKLLEKQFEFNDEMKQIQQNVMSELKSVKKELK 74

  Fly   463 --SKIKVNVEEKEKTNLILQK-----QIEEHKEK-IAHLEAVKNEMKEKFDDVVKQKEIQELDII 519
              :.||..:|..|....|.:|     |::|::.| |.:|.:....:|.:.::..||:|.||..|.
 Worm    75 QATSIKDLLEILEIIQKIFKKQDEFQQVQENQNKSIENLNSELKTVKAELNETKKQQESQEKLID 139

  Fly   520 STSENLRLNCLKVEELNGNLNDTLEKLSNAESQINAK-------------TEDIEKMLKAFEAEK 571
            ::.:||:|           :.:::.|...::.||..|             |.::.|:...||   
 Worm   140 NSDKNLKL-----------ILESILKFQKSQDQIMMKIMEGSAVQDVPLGTVELTKIDPFFE--- 190

  Fly   572 ALLLTQIEQQSV-ESKSHSEAQNAQLQEIMDNLEQKDKEFNEV-KLQLSSAESQISLKALEIQNN 634
             :|:...|...: .|::|.:.:...    .|.:.......|.: |:.:||....:..|.||..::
 Worm   191 -ILVIWTESCGIFASENHWKLRVCG----SDTIRHIKLRINSLAKVDISSFRMVLRGKLLEDHHS 250

  Fly   635 LKAFEAEKSVLL 646
            |..:..::..|:
 Worm   251 LAYYNIQEGALI 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961
TMPIT 402..>504 CDD:285135 30/114 (26%)
I_LWEQ 973..1120 CDD:279885
C16C8.16NP_494544.2 UBQ 204..267 CDD:294102 12/64 (19%)
UBQ 206..267 CDD:214563 11/62 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.