DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and LOC110440078

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_021335166.1 Gene:LOC110440078 ID: Length:352 Species:Danio rerio

Alignment Length:230 Identity:90/231 (39%)
Similarity:150/231 (65%) Gaps:1/231 (0%)


  Fly   891 LLEIELREMDAAIDDAASKITDLLAKAREKDNQTNLEVNGKIVDACTTLMECVKALIQKSRLLQH 955
            :::.|:....:||:||..::.::|.:.|.:.....||||..|:.:|:.||:.:..|:..|..||.
Zfish     1 MVDKEMSATSSAIEDAVLRMEEILNQTRRETTGVKLEVNQSILGSCSDLMKAIHMLVTASTDLQR 65

  Fly   956 EIVASQKGNASANEFYRRNSQWSDGLISASKSVAKAANYLVEAANKAIESESGKNFELIVAAQEI 1020
            :||.|.:|:.||.:||.:||:|::|||||||:|...|..::::|:|.: ::.||..||||.:.||
Zfish    66 DIVESGRGSGSAKDFYAKNSRWTEGLISASKAVGWGATQMLDSADKVV-TDRGKYEELIVCSHEI 129

  Fly  1021 AACTTQMVIASKVKAERNSQKLTDLTKASRSVTQATGTLVATVKDCNSQLEQQSEIELSKLTPSQ 1085
            ||.|.|:|.||||||:|.::||..|.:|||.|......:|.:.|....|:|.::.::.|.|:..:
Zfish   130 AASTAQLVAASKVKADRGNKKLHTLQQASRHVNDMAAVVVTSTKSGQMQIEDKNSMDFSGLSLIK 194

  Fly  1086 IKTMEMEIHVKVLEIEQALQMQRLKLSSFRKEHYK 1120
            :||.||:..|:|||:|:.|..:|::|...||:||:
Zfish   195 LKTEEMDTQVRVLELEKQLCSERVRLGELRKKHYE 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961
TMPIT 402..>504 CDD:285135
I_LWEQ 973..1120 CDD:279885 63/147 (43%)
LOC110440078XP_021335166.1 ILWEQ 33..230 CDD:214607 83/199 (42%)
Sec23_BS <236..>298 CDD:331630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.