DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and LOC110440077

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_021335163.1 Gene:LOC110440077 ID: Length:361 Species:Danio rerio

Alignment Length:414 Identity:85/415 (20%)
Similarity:172/415 (41%) Gaps:85/415 (20%)


  Fly   544 EKLSNAESQINAKTEDIEKMLKAFEAEKALLLTQIEQQSVESKSHSEAQNAQLQEIMDNLEQKDK 608
            :.|.|.:|.:..:.|                  :.:::|.|..:|.:::..:.||::..:|:..:
Zfish     5 QTLQNQQSSLQQERE------------------KHQRESAELHTHLQSKACREQELLLEIERLKR 51

  Fly   609 EFNEVKLQLSSAESQISLKAL---EIQNNLKAFEAEKSVLLTKIEQLGIEHKNNSEAQNAQLQLT 670
            |..|.:.:|..|:|.::.||.   ::.:.|...:|||.|||..::        :.|::...|:.|
Zfish    52 ELEETRAELMRAQSALNNKASAGDQLSSVLVGLQAEKDVLLRSVK--------DQESEIMSLRQT 108

  Fly   671 LNNLEQNESALQQTQEIVNQLRQENASAGQRNEDLQSKLSLTEVKLTQATQQIDAVTSSYQICST 735
            |.|   .:|.|||.:|     :.:..|| :.:..||||:|.......|..|.     ..:.:...
Zfish   109 LQN---QQSGLQQERE-----KHQRESA-ELHTHLQSKVSQDSGVWQQKLQD-----EQFSLLQC 159

  Fly   736 DLSELRKLVIKTVKEI-------CNSK---LSGSEQQPLDAVPNIIREMETILNKFNNASAINYV 790
            .:.|...:|:..|.::       |.|.   |....:..|.:|..:.|.....:...::||.:   
Zfish   160 AVVEAEGIVLDAVAKVDDPLHVRCISTPDYLINRAELTLASVDKMQRSHAAYIRNMDDASGL--- 221

  Fly   791 ASTEGLQNVMYLGYVFIKLYDQCDVIYKTTTAIETGQEIFSKTNLLCTDICQ-----LFQYLLNN 850
                 |::|....::.      .|.|.....|..:...  .:.:.| ||.|:     ..|||...
Zfish   222 -----LRSVTQFSHLI------ADTIVNGAGAAHSAPT--DQADRL-TDNCRDCATHCLQYLKEL 272

  Fly   851 ETK------EPERQKTITDIQTKLRDIEKLIEKIKASFEQKIDLDKLLEIELREMDAAIDDAASK 909
            :.|      :|...:.:  :|..|...:.|  :.:|:..::.:|..:::.|:....:||:||..:
Zfish   273 KLKATLPRADPTAVRCV--LQRILHQGQDL--RPRAADVRQEELADMVDKEMSATSSAIEDAVLR 333

  Fly   910 ITDLLAKAREKDNQTNLEVNGKIV 933
            :.::|.:.|.:.....||||.:.|
Zfish   334 MEEILNQTRRETTGVKLEVNQRSV 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961
TMPIT 402..>504 CDD:285135
I_LWEQ 973..1120 CDD:279885
LOC110440077XP_021335163.1 SMC_N <17..>177 CDD:330553 43/200 (22%)
HIP1_clath_bdg <17..91 CDD:318670 19/92 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.