DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and LOC103910581

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_021335154.1 Gene:LOC103910581 ID: Length:557 Species:Danio rerio

Alignment Length:517 Identity:162/518 (31%)
Similarity:266/518 (51%) Gaps:27/518 (5%)


  Fly     5 AEKE-FYHLNV-SVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKF 67
            |||| |..|.: |:||::...|||:|.|:||.|::..|....|.|||......||..:...:|||
Zfish    23 AEKEQFVKLQLQSISKSITSAEAPIKEKYARKILLGTHTEGGAVTFWSHAISLPLSSNAILSWKF 87

  Fly    68 SHLLHKVLREGHESAIRHSQSHKKMILEVGKMWGLLQDDIGCCIQAYSKLLATKLNFHDKNRMFP 132
            .|::||:||:||.:.:|.|:||...|.::|.:||.|.|..|..:..|||||..|::||.|:...|
Zfish    88 CHMVHKLLRDGHPNMVRDSRSHTAAIRQMGILWGNLHDRYGHIVALYSKLLCIKIDFHLKHPEIP 152

  Fly   133 GTLNISFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPI 197
            ..|..|...|...:..|:|..|.:..|:.||:|..:.||.|:|..|:.:..||.|..|||||||:
Zfish   153 ANLEASEEVLDKVIAIDINKVFDITGEVLDYMEAGLKLQETVFRQMDSHSTSSTTAVGQCRLAPL 217

  Fly   198 VCLIQDSNALYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPE 262
            |.|||||..||...|:|:||||..:|.|.:.||||||...|..|..|:...|.:::||.:|.||:
Zfish   218 VLLIQDSGPLYHFLVKLLFKLHSRIPVDALLGHRDRFRDHFNSLTEFFERARGIEFFKTIIQIPD 282

  Fly   263 LPDSSPNFKSQNDFTSYVPPVVHVPQEPDPVVEDLVDTNNHELEAFSQAQ-------QQLSMLEG 320
            ||:..|||........:|.||  |.|....|.:|..:|.    ..||:.|       .|......
Zfish   283 LPNEPPNFLRAASLADHVKPV--VVQNERFVYDDETETQ----ADFSEGQFQPYYGFNQFDYPVD 341

  Fly   321 IISEKEASIEELSFKLDAMQKNFDALQQSYRHDVQELQQNNTVLSNDLVLAREMCATFRMQNDDL 385
            :..::|...:.|..:|:.::...:.::...:..|.:|:.....|.::|...|.......::|:.|
Zfish   342 VPEQRETEADSLRKELEVVKPELELIKVEAQRAVVQLKSQVNKLESELEEQRTHKQMALVENERL 406

  Fly   386 EMQLN----QNPILLQKAMEEEEKHKLSSE-KFNKLKTLYTKIRDEHIQLLREQSDCNKSLNKEK 445
            .||:.    :|...:|..:|:......::: .|.:||..:.::...|..|:|:.::..|..:..:
Zfish   407 RMQVENMRMENTASVQATVEDHSNRAQTAQIHFARLKEKHAELVSRHADLMRKNAEMLKQKSSGQ 471

  Fly   446 QVNSQLLLETKELTNEISKIKVNVEEKEKTNLILQKQIEEHKEKI----AHLEAVKNEMKEK 503
            |...:||...:::..|:.::.::...|.:..   :.:||..|:::    |.:..|.|.::.|
Zfish   472 QAQEELLAYRQQVAQEMQQLTLDNNSKLEAQ---RAEIERLKQELVSGRAEVSQVHNALQSK 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 113/273 (41%)
TMPIT 402..>504 CDD:285135 19/108 (18%)
I_LWEQ 973..1120 CDD:279885
LOC103910581XP_021335154.1 VHS_ENTH_ANTH 32..293 CDD:321980 110/261 (42%)
SMC_N <344..>539 CDD:330553 34/191 (18%)
HIP1_clath_bdg 453..538 CDD:318670 16/82 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32719276
eggNOG 1 0.900 E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 458 1.000 Inparanoid score I1509
OMA 1 1.010
OrthoDB 1 1.010 D86898at33208
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T596992
orthoMCL 1 0.900 OOG5_129034
Panther 1 1.100 O PTHR10407
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.