DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and hip1

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_002933593.2 Gene:hip1 XenbaseID:XB-GENE-983522 Length:935 Species:Xenopus tropicalis

Alignment Length:1133 Identity:335/1134 (30%)
Similarity:531/1134 (47%) Gaps:242/1134 (21%)


  Fly    12 LNVSVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKFSHLLHKVLR 76
            :.||::||:|..||.:|.||||:.|:..|..|.|:|||..::|.||..:....|||.|:.||:||
 Frog     6 MTVSINKAINTQEAAVKEKHARTCILGTHHEKGAQTFWTAVNRLPLSSNAVLCWKFCHVFHKLLR 70

  Fly    77 EGHESAIRHSQSHKKMILEVGKMWGLLQDDIGCCIQAYSKLLATKLNFHDKNRMFPGTLNISFTE 141
            :||.|.:|.|..:|..::::.:|||.|.:..|.....|.|||..|:.||.||..|||.|.::..:
 Frog    71 DGHPSVLRDSLRYKSELIDMSRMWGHLSEGYGQLCSIYLKLLIIKMEFHTKNPRFPGNLQMTDRQ 135

  Fly   142 LFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPIVCLIQDSNA 206
            |..|.:.|:|..|||.||||||:|..:.|..|:|.|::..|..|:|..|||||:|::.:|.|.:.
 Frog   136 LDEAGENDVNNFFQLTVEIFDYMEWELNLFHTVFKSLDMSRSVSVTAAGQCRLSPLIQVILDCSH 200

  Fly   207 LYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPELPDSSPNFK 271
            |||.:|:|:||||..:|.|.:.||||||...|.|||..:.....|||||.|:.||:||::.|||.
 Frog   201 LYDYTVKLLFKLHSCLPTDTLQGHRDRFVEQFQKLKDLFYRSSNLQYFKRLLQIPQLPENPPNFL 265

  Fly   272 SQNDFTSYVPPVVHVPQEPDP-------VVEDLV--DTNNHELEAFSQAQQQLSMLEGIISEKEA 327
            ..:..:.::.|||.:|.|..|       ..||||  ||.:|:                       
 Frog   266 RASALSEHISPVVLIPSENSPPDSETLIETEDLVGMDTLSHQ----------------------- 307

  Fly   328 SIEELSFKLDAMQKNFDALQQSYRHDVQELQQNNTVLSNDLVLAREMCATFRMQNDDLEMQLNQN 392
            |:.|.:|.        |....|:.:|.......|                 .|:.||.:..:.| 
 Frog   308 SLSENTFD--------DIFGSSFSNDPFNFSNQN-----------------GMRRDDKDHLIEQ- 346

  Fly   393 PILLQKAMEEEEKHKLSSEKFNKLKTLYTKIRDEHIQLLREQSDCNKSLNKEKQVNSQLLLETKE 457
             :..:.||..:|.....||....:..|..:|::...:|.           ::|.:..|.:.|.:.
 Frog   347 -LYKEIAMLRDEFGNFKSESHRLVTNLKGRIQELEAELA-----------EQKHLREQAVDENEF 399

  Fly   458 LTNEISKIKVNVEEKEKTNLILQKQIEEHKEKIAHLEAVKNEMKEKFDDVVKQKEIQELDIISTS 522
            |..|:..:|...|:.||.    |:.:.|.:.|....|....::|||:.::|....          
 Frog   400 LRTELEDLKRRREDTEKA----QRSLTEIERKSVANEQRYTKLKEKYAELVHSHA---------- 450

  Fly   523 ENLRLNCLKVEELNGNLNDTLEKLSNAESQINAKTE---DIEKMLKAFEAEKALLLTQIEQQSVE 584
                              |.|.|.:....|::...|   |.|:..|..|..     .|...:..:
 Frog   451 ------------------DLLRKNAEVTKQVSVAREALVDTERSKKELEDS-----YQRVNEHTQ 492

  Fly   585 SKSHSEAQNAQLQEIMDNLEQKDKEFNEVKLQLSSAESQISLKALEIQNNLKAFEAEKSVLLTKI 649
            .|:|.     |::| ||.| |...|.|:.::.|..|    |::|.:.:..::..|.::||:    
 Frog   493 RKAHE-----QIKE-MDQL-QGALESNKQEIHLLKA----SIEASKQEGQIRIMELKESVI---- 542

  Fly   650 EQLGIEHKNNSEAQNAQLQLTLNNLEQNESALQQT----QEIVNQLRQENASAGQRNEDLQSKLS 710
                                        :..||:.    ||.:.||.:.:.|:|..:.|.....:
 Frog   543 ----------------------------DRVLQEAEFIIQESLRQLDEPHYSSGMISTDFLITRA 579

  Fly   711 LTEVKLTQATQQIDAVTSSYQICSTDLSELRKLVIKTVKEICNSKLSGSEQQPLDAVPNIIREME 775
            |..|   |:|::::....::....:|::.|...:::....|....|.|:.....|.:.:..|...
 Frog   580 LAAV---QSTEKMEEAWKAHMANPSDITLLLPPLVQFAHRISEVILQGALTPTSDRLNDGCRTCG 641

  Fly   776 TILNKFNNASAINYVAS-----TEGLQNVMYLGYVFIKLYDQCDVIYKTTTAIETGQEIFSKTNL 835
            |        .|::|::|     |||..:              |.   :.|.|:            
 Frog   642 T--------EALSYLSSLQKNETEGSVH--------------CS---RVTAAL------------ 669

  Fly   836 LCTDICQLFQYLLNNETKEPERQKTITDIQTKLR----DIEKLIEKIKASFEQKIDLDKLLEIEL 896
                                   |.|::|..:||    ||            ::.:|..|:|.|:
 Frog   670 -----------------------KNISEIAQELRPPTLDI------------REEELGDLVEKEM 699

  Fly   897 REMDAAIDDAASKITDLLAKAREKDNQTNLEVNGKIVDACTTLMECVKALIQKSRLLQHEIVASQ 961
            ....||::.||::|.::|.|:|..|....|:||.:|:.:||.||:.::|||..|:.||.|||.|.
 Frog   700 AATAAAVETAATRIEEMLNKSRTDDTGVKLQVNERILGSCTDLMQGIQALILASKDLQKEIVESG 764

  Fly   962 KGNASANEFYRRNSQWSDGLISASKSVAKAANYLVEAANKAIESESGKNFELIVAAQEIAACTTQ 1026
            :|.||..|||.|||:|::|||||||:|...|..:|:||:..::.: ||..:|||.:.||||.|.|
 Frog   765 RGAASQKEFYARNSRWTEGLISASKAVGWGATVMVDAADLVVQGQ-GKFEDLIVCSHEIAASTAQ 828

  Fly  1027 MVIASKVKAERNSQKLTDLTKASRSVTQATGTLVATVKDCNSQLEQQSEIELSKLTPSQIKTMEM 1091
            :|.|||||||:::..|:.|.:||:.|.|....:||:.|...||:|::..::.|.:|.:|||..||
 Frog   829 LVAASKVKAEKDNANLSRLQQASKVVNQNAAGVVASTKCVMSQIEEKDTMDFSSMTLTQIKRKEM 893

  Fly  1092 EIHVKVLEIEQALQMQRLKLSSFRKEHY 1119
            :..|:|||:|..||.:|.||...||:||
 Frog   894 DSQVRVLELENELQKEREKLGELRKKHY 921

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 117/269 (43%)
TMPIT 402..>504 CDD:285135 22/102 (22%)
I_LWEQ 973..1120 CDD:279885 68/148 (46%)
hip1XP_002933593.2 ANTH 7..274 CDD:284961 117/267 (44%)
TACC 339..562 CDD:282818 60/316 (19%)
RILP-like <372..460 CDD:304877 23/131 (18%)
HIP1_clath_bdg 449..530 CDD:293123 24/125 (19%)
ILWEQ 726..924 CDD:214607 92/198 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32704222
eggNOG 1 0.900 E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.722 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.