DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and hip1r

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_012810604.1 Gene:hip1r XenbaseID:XB-GENE-986342 Length:1066 Species:Xenopus tropicalis

Alignment Length:1173 Identity:350/1174 (30%)
Similarity:554/1174 (47%) Gaps:242/1174 (21%)


  Fly     5 AEKEFYHLN--VSVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKF 67
            ||:|.:..|  :|:|||:|..|||:|.||||.||:..|..|.|.|||......||..|...:|||
 Frog    22 AEREQFDRNQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLPSSSILSWKF 86

  Fly    68 SHLLHKVLREGHESAIRHSQSHKKMILEVGKMWGLLQDDIGCCIQAYSKLLATKLNFHDKNRMFP 132
            .|:||||||:||.:.:...|.::..|.|.|::||.:.|..|..:..|:|||..|::||.|:..||
 Frog    87 CHVLHKVLRDGHPNVLSDCQRYRSNIRETGELWGHMHDRYGQLVNIYTKLLLNKISFHVKHPEFP 151

  Fly   133 GTLNISFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPI 197
            ..|.::...|..:...|:|..|||.||:|||::..:.|...:|..:......|....|||:|||:
 Frog   152 PGLEVTDDVLEKSAGTDVNNIFQLTVEMFDYMDCELKLAEAVFRQLNSSIAVSQMAAGQCKLAPL 216

  Fly   198 VCLIQDSNALYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPE 262
            :.:|||.:.||..:|:||||||..:|.|.:.|||||||..|..||:|:.....:.|||.||.||.
 Frog   217 IQVIQDCSHLYHYTVKLMFKLHSCLPPDTLQGHRDRFHEQFHSLKNFFKRASDMLYFKRLIQIPR 281

  Fly   263 LPDSSPNFKSQNDFTSYVPPVVHVPQ---EPDPVVEDLVDTNNHELEAFSQAQQQLSMLEGIISE 324
            |||..|||...:....:|.|||.:|.   |.:...|.|::        .|.||.         .|
 Frog   282 LPDGPPNFLRASALAEHVKPVVVIPNETPEDEEPAESLIE--------ISAAQP---------VE 329

  Fly   325 KEASIEELSFKLDAMQKNFDALQQSYRHDVQELQQNNTVLSNDLVLAREMCATFRMQNDDLEMQL 389
            :|..:|:|      .|:.|.|                   .|.|:            .||.::|:
 Frog   330 QEQVVEDL------FQQTFGA-------------------PNGLM------------KDDRDLQI 357

  Fly   390 NQNPILLQKAME----EEEKHKLSSEKF-----NKLKTLYTKIRDEHIQLLREQSDCNKSLNKEK 445
            ..    |||.:|    |.||.||.::|:     .::.||..::.::               .|:|
 Frog   358 EN----LQKEIELLRAELEKIKLEAQKYILQLKGQINTLEAELEEQ---------------RKQK 403

  Fly   446 QVNSQLLLETKELTNEISKIKVNVEEKEKTNLILQKQIEEHKEKIAHLEAVKNEMKEKFDDVVKQ 510
            |   :.|::.::|.:|:.|:|....|.|||..:|.    |.::||...|....::|||.:     
 Frog   404 Q---KALVDNEQLRDELEKLKKQKLENEKTQGVLL----EAEKKIQATELRYTKLKEKHN----- 456

  Fly   511 KEIQELDIISTSENLRLNCLKVEELNGNLNDTLEKLSNAESQINAKTEDIEKMLKAFEAEKALLL 575
                  ::|:|...|                 |.|.::...|:....::.|::.:.    |..|.
 Frog   457 ------ELINTHAGL-----------------LRKNADTAKQLTVSQQNQEEVARI----KEELE 494

  Fly   576 TQIEQQSVESKSHSEAQNAQLQEIMDNLEQKDKEFNEVKLQLSSAESQISLKALEIQNNLKAFEA 640
            .|::|...||....|.|:.|.:::...:|.|.||...::..|||.|...|    ::.:.|.:.|.
 Frog   495 FQMDQVKRESDLKLEDQSFQTEQLKSEIEAKKKELLLIQQSLSSTEESKS----QLNSTLMSLEV 555

  Fly   641 E----KSVLLTKIEQLGIEHKNNSEAQNAQLQLTLNNLEQNESALQQTQEIVNQLRQENASAGQR 701
            |    ||:|.||..:|       |.|||               ..:.|:.:.||.:::.||   .
 Frog   556 EKDTLKSLLTTKESEL-------SSAQN---------------LARDTETLFNQEQEKKAS---E 595

  Fly   702 NEDLQSKLSLTEVKLTQATQQI--DAVTSSYQICSTDLSELRKLVIKTVKEI-------CNSK-- 755
            ..||..||:    |.|...|::  ..:...:.|....:.|...::...|.::       |.|.  
 Frog   596 IRDLHEKLN----KKTTDEQKLYQKMLEDQFNIIQGTVREAENIIQDAVAKLDDPLHIRCTSSPD 656

  Fly   756 -LSGSEQQPLDAVPNI-------IREM------------------ETILNKFNNASAINYVASTE 794
             |....|..||::|::       |:.|                  :||:    |.||.:::|..:
 Frog   657 YLVCRAQAALDSIPHLENGHAKYIQNMTDASDLVGALAQFAHLTADTIV----NGSATSHLAPPD 717

  Fly   795 GLQNVMYLGYVFIKLYDQCDVIYKTTTAIETGQEIFSKTNLLCTDICQLFQYLLNNETKEPERQK 859
            ...          :|.|.|.         |.|.              |...||.:.:.|...:..
 Frog   718 HAD----------RLNDSCK---------ECGN--------------QSLDYLSSLKNKHSLKNA 749

  Fly   860 TITDIQTKLRDIEKLIEKIK---ASFEQKIDLDKLLEIELREMDAAIDDAASKITDLLAKAREKD 921
            .:.::...|:.|..|.::::   ...:|: :|..:::.|:....|||:.|..:|.:::.:||:..
 Frog   750 DLAEVNRSLKRIFDLGQELRPKSLDIKQE-ELGDMVDKEMASTSAAIEAAVRRIEEMMNQARKDS 813

  Fly   922 NQTNLEVNGKIVDACTTLMECVKALIQKSRLLQHEIVASQKGNASANEFYRRNSQWSDGLISASK 986
            :...||||.:|:::||.||:.::.|:..|..||.|||.|.:|.|:..|||.:||:|::|||||||
 Frog   814 SGVKLEVNERILNSCTDLMKAIRLLVITSTDLQKEIVESGRGAATTQEFYAKNSRWTEGLISASK 878

  Fly   987 SVAKAANYLVEAANKAIESESGKNFELIVAAQEIAACTTQMVIASKVKAERNSQKLTDLTKASRS 1051
            :|...|..|||:|:|.: ...||..||||.:.||||.|.|:|.||||||::||:.|..|.:.||.
 Frog   879 AVGWGATQLVESADKVV-LHKGKYEELIVGSHEIAASTAQLVAASKVKADKNSKNLPKLQQCSRH 942

  Fly  1052 VTQATGTLVATVKDCNSQLEQQSEIELSKLTPSQIKTMEMEIHVKVLEIEQALQMQRLKLSSFRK 1116
            |.:....:||:.|....|:|.:..::.|.::..::|..|||..|||||:|..||.:|::|...|:
 Frog   943 VNEMAANVVASTKSGQEQIEDKDTMDFSGMSLIKLKKEEMESQVKVLELENMLQNERMRLGELRR 1007

  Fly  1117 EHY 1119
            :||
 Frog  1008 QHY 1010

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 115/274 (42%)
TMPIT 402..>504 CDD:285135 28/107 (26%)
I_LWEQ 973..1120 CDD:279885 66/148 (45%)
hip1rXP_012810604.1 ANTH 28..300 CDD:284961 115/272 (42%)
Filament 353..619 CDD:278467 83/357 (23%)
DUF342 <356..441 CDD:302792 28/111 (25%)
HIP1_clath_bdg 462..560 CDD:293123 26/123 (21%)
ILWEQ 815..1013 CDD:214607 88/198 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32703836
eggNOG 1 0.900 E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.730 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1344
TreeFam 1 0.960
87.750

Return to query results.
Submit another query.