DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10973 and mrpl-16

DIOPT Version :10

Sequence 1:NP_001034002.1 Gene:CG10973 / 39447 FlyBaseID:FBgn0036306 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_497965.2 Gene:mrpl-16 / 188040 WormBaseID:WBGene00011412 Length:240 Species:Caenorhabditis elegans


Alignment Length:124 Identity:25/124 - (20%)
Similarity:46/124 - (37%) Gaps:50/124 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 IASLTSIEKSVRDDFVKEEVFPVLVENLK------------PVDDF-DIKQETTLFALSSLSRES 260
            :|:||...:.     :|:..|||..||::            |.:.| |             :.:.
 Worm    12 VANLTQFTRG-----MKKYSFPVTYENVRFPPNGQLKLPVMPAEPFYD-------------AEKG 58

  Fly   261 ELKLSTEKR-------EEILSKL--QQI--------ISKNKQSETCEDMVNYARNIFDN 302
            |.|..:.||       ||:.::|  :|.        ...:...:..:|.:|  :|:.||
 Worm    59 EKKYKSTKRMIEARGVEEVHTELIHEQYGLAAVSGGFIDSDDFKFIQDRIN--KNLIDN 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10973NP_001034002.1 Fes1 13..94 CDD:462534
armadillo repeat 97..128 CDD:293788
armadillo repeat 136..172 CDD:293788
armadillo repeat 178..209 CDD:293788 25/124 (20%)
mrpl-16NP_497965.2 Ribosomal_L16 60..188 CDD:459733 12/58 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.