DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klc and Appbp2

DIOPT Version :10

Sequence 1:NP_524049.1 Gene:Klc / 39445 FlyBaseID:FBgn0010235 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_080101.1 Gene:Appbp2 / 66884 MGIID:1914134 Length:585 Species:Mus musculus


Alignment Length:217 Identity:57/217 - (26%)
Similarity:102/217 - (47%) Gaps:17/217 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 VIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYR-----------DQNKYKE 246
            |.||:| |:::.|:...::|:..:......||..:|:...:.||:..           :|...:|
Mouse   342 VHQYSS-GKFDNALFHAERAIGIITHILPEDHLLLASSKRVKALILEEIAIDCHNKETEQRLLQE 405

  Fly   247 AANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDV 311
            |.:|...:|.:..|..||.:...|....||..||....|:|:||.:..:|::|:|::||::..:|
Mouse   406 AHDLHLSSLQLAKKAFGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEV 470

  Fly   312 AKQLNNLALLCQ-NQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEI 375
            |..:.:||.|.. :..:|:..||.|.|::.|.:...|.....:......|...|...|.| |...
Mouse   471 ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNY-EKVF 534

  Fly   376 LYKQVLT---RAHEREFGAIDS 394
            .|..||:   |..:|::...|:
Mouse   535 EYHNVLSNWNRLRDRQYSVTDA 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KlcNP_524049.1 TPR 183..>391 CDD:440225 56/212 (26%)
TPR repeat 187..214 CDD:276809 7/20 (35%)
TPR repeat 228..256 CDD:276809 7/38 (18%)
TPR repeat 270..298 CDD:276809 10/27 (37%)
TPR repeat 311..341 CDD:276809 10/30 (33%)
TPR repeat 354..381 CDD:276809 6/26 (23%)
Appbp2NP_080101.1 TPR 1 50..83
TPR 2 120..153
TPR 3 206..239
TPR 4 288..321
TPR 5 333..367 7/25 (28%)
Spy 370..>577 CDD:443119 50/188 (27%)
TPR_12 427..504 CDD:315987 25/76 (33%)
TPR 6 429..462 12/32 (38%)
TPR 7 471..505 10/33 (30%)
TPR 8 514..547 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.