DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ptp69D and ptprfb

Sequence 1:NP_524048.2 Gene:Ptp69D FlyBaseID:FBgn0014007 Length:1462 Species:Drosophila melanogaster
Sequence 2:XP_009296732.1 Gene:ptprfb ZFINID:ZDB-GENE-060503-530 Length:1927 Species:Danio rerio

Alignment Length:1821 Identity:421/1822 (23%)
Similarity:690/1822 (38%) Gaps:571/1822 (31%)


  Fly    38 GKNVSLECASENEA---VAWKLGNQTINKNHTRYKIRTEPLKSNDDGSENNDSQDFIKYKNVLAL 99
            |.:|:|.|.:....   |.|..|...:.|:                       ::....:|||.|
Zfish   261 GGSVNLTCVAVGAPMPYVKWMTGEVELTKD-----------------------EEMPVGRNVLEL 302

  Fly   100 LDVNIKDSGNYTC-----------TAQT------------------------------------- 116
              .||:.|.||||           |||.                                     
Zfish   303 --TNIRQSTNYTCVAISSLGMIEATAQVSVKALPKPPTSLTVTETTATSVTLTWDSGNPEPVSYY 365

  Fly   117 -----GQNHSTEFQ--------------VRPYL----------------PSKVLQ---------S 137
                 .:...|.||              :.||.                ||:.::         |
Zfish   366 IIQYRAKTSDTNFQEVDGVATTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSEPVETRTGEQAPSS 430

  Fly   138 TPDRIK-RKIKQDVMLYCLIEMYPQNETTNRNLK----------------WLKDGSQFEFLDTFS 185
            .|..:: |.:....|   |::..|..| .|..::                |.|..:....|.|.|
Zfish   431 PPLHVQARMLSASTM---LVQWEPPEE-PNGQIRGYRIYYTSDLDAPLSAWQKHNTDDSRLTTIS 491

  Fly   186 SISKLNDTHLNFTLE---FTEV----------YKKENGTYKCTVFDDTGLEITSKEITLFVMEVP 237
            |::    |.:.::|.   ||.|          .|.:.|                         ||
Zfish   492 SLT----TGITYSLRVLGFTSVGDGPPSDVLQVKTQQG-------------------------VP 527

  Fly   238 QVSIDF-AKAVGANKIYLNWTVNDGNDPIQKFFITLQEAGTPTFTYHKDFINGSHT------SYI 295
            .....| |:|....:|.|.| :....|||.|:.:...||         |..|..|.      ||.
Zfish   528 AQPSSFEAEAELDTRILLTW-LWPVQDPIIKYELQYWEA---------DSDNKIHVTFDPAGSYA 582

  Fly   296 LDHFKPNTTYFLRIVGKNSIGNG-------------QPTQYPQGI-------------------- 327
            ::..||:|.|...:..::.:|.|             .|:..||.:                    
Zfish   583 VEGLKPDTLYKFSLAARSEMGQGVFTHPIEARTAQSAPSAPPQDVHLLSLSSTSIKVSWVAPPAA 647

  Fly   328 --------TTLSYDPI------------------------------------------------- 335
                    .|:||..:                                                 
Zfish   648 SRHGAIVRYTVSYQAVNGEDTERHEVPDIGADASSCVLEGLEKWTEYQVWVRAHTDVGPGPESTA 712

  Fly   336 -------FIP-------KVETTGSTASTITIGWNPP-PPDLIDYIQYYELIVS--ESGEV---PK 380
                   .:|       :||...|||..:|  |.|| .......|:.|::|.|  |:||.   |.
Zfish   713 VRIRTNEDVPGAPPRKLEVEALNSTAIRVT--WKPPLSGKQHGQIRGYQVIYSRLENGEPRGHPN 775

  Fly   381 VIEEAIYQQNSRNLPYMFDKLKTATDYE-----------FRVRACSDLTKTCGPWSENVNGTTMD 434
            :::.|        ||....|::.:|:||           :.|...:..||..|..|:....||..
Zfish   776 IMDVA--------LPEAQWKIEESTEYEAVIAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTG 832

  Fly   435 GVATKPTNLSIQCHHDNVTRGNSIAINWDVPKTPNGKVVSYLI---------------------- 477
            .|..|||.:.      :.|.||:..|.|..||...|:::.|.:                      
Zfish   833 AVPGKPTMII------STTVGNTALIQWQPPKDMVGELMGYRLRYKRLEEENYEIREFSRTDDHH 891

  Fly   478 -------------HL---------------LGNP----------------MSTVDREMWGPK--- 495
                         ||               :|.|                .::..|..|.|.   
Zfish   892 TVTDLHKGATYSFHLSARNRAGLGEEYVKDIGTPEDVPSGFPLNLQVVGLTTSTTRLTWEPPALS 956

  Fly   496 ------------IRRIDEPHHKT--------LYESVSPNTNYTVTVSAITRHKKNGEPATGSC-L 539
                        .|.|:...:.|        ..:.:.|:|.|.:.|.|.|  .|.|.|.:.|. .
Zfish   957 ERNGRIIHYIVVYRDINSKQNSTNRTSDTQMTIQGLRPDTTYDIRVQAFT--SKGGGPISPSIQS 1019

  Fly   540 MPVSTPDAIGRTMWSKVNLDSKYVLKLYLPKISERNGPICCYRLYLVRINNDNKELPDPEKLNIA 604
            ..:||..|...:...|..:.:..:|...:|:..:...|      :.:..|..:.|:....|..:.
Zfish  1020 RTMSTSPAFATSFGVKAVMKTSVLLTWEVPENYKSQVP------FKILYNQQSVEVQGNLKRKLI 1078

  Fly   605 TYQEVHSD------NVTRSSAYIAEMISSK------YFRPEIFLGDEKRFSENNDIIRDNDEICR 657
            |..:..:|      :...|:..:.:.:|.:      ..:|.::..|:    .||..:..|   ..
Zfish  1079 TRLQPDTDYSFVLMSRGNSAGGLQQQVSIRTAPDLFKTKPVLYTADQ----TNNGKLTIN---LP 1136

  Fly   658 KCLEGTPFLRKPEIIHIPPQGSLS----NSDS-ELPILSEKDNLIKGANLTEHALKILESKLRDK 717
            |.....| :|...|:.:|...:.|    |.|. ||..|.|..   :||:|.             :
Zfish  1137 KVPTSAP-VRCYYIVVVPVSQTSSRQWINPDEMELDELLESS---EGAHLR-------------R 1184

  Fly   718 RNAVTSDENPILSAVNPNVPLHDSSRDVFDGEIDINSNYTGFLE--------------------- 761
            |...|....|.::|....:|...:..|..|        |:||:.                     
Zfish  1185 RRRHTDTVRPYIAAKLSTLPETFTLGDELD--------YSGFINRPLPNNQHFQCFVMAELKDQY 1241

  Fly   762 -IIVRDRNNALMAYSKYFDIITPATEAEPIQSLNNMDYYLSIGVKAGAVLLGVILVFIVLWVFHH 825
             :...::.....| |.|.|.|....|.:..:|::..:....:|.....||:.:|::.|:|:    
Zfish  1242 PVTANEKQRTFSA-SPYSDPIIVQGENQMQRSVDQPEMLWVMGPVLAVVLIIIIVIAILLF---- 1301

  Fly   826 KKTKNE---------------------LQGEDTLTLRDSLSRALFGRRNHNHSHFITSGNHKGFD 869
             |:|.|                     ....|.:.:| .|:....|.|.|.........:|    
Zfish  1302 -KSKQERKRASPLPKDDHSGGVKDCLLASSSDPVEMR-RLNYQTPGMREHPPISVSELADH---- 1360

  Fly   870 AGPIHRLDLENAYKNRHKDTDYGFLREYEML-PNRFSDRTTKNSDLKENACKNRYPDIKAYDQTR 933
               |.||...:|.:         |.:|||.: |.:  ..|.:||:|:.|..||||.::.|||.:|
Zfish  1361 ---IERLKANDALR---------FSQEYESIDPGQ--QFTWENSNLEVNKPKNRYANVIAYDHSR 1411

  Fly   934 VKLAVINGLQTTDYINANFVIGYKERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYN 998
            |.|..::|:..:||||:|::.||:::..:|..|||:..|:.|||||||||....|||:|.|||.:
Zfish  1412 VVLTPVDGVPGSDYINSNYIDGYRKQNAYIATQGPLPETLSDFWRMIWEQRASTIVMMTRLEEKS 1476

  Fly   999 KAKCAKYWPEKVFDTKQFGDILVKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLTW 1063
            :.||.:|||  :..|:.:|.|.|......:...|..||..:.||.::     ::|::.|:.::.|
Zfish  1477 RVKCDQYWP--IRGTETYGMIQVTMLDAVELATYSVRTFALYKNGSS-----EKREVRQFQFMAW 1534

  Fly  1064 KDFMAPEHPHGIIKFIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVSIYNT 1128
            .|...||:|..|:.|:|::.:......||::|||||||||||..:.:|:::::::.|.:|.||..
Zfish  1535 PDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGH 1599

  Fly  1129 VCDLRHQRNFLVQSLKQYIFLYRALLDTGTFGNTDICIDTMASAIESLKRKPNEGK--CKLEVEF 1191
            |..:|.|||::||:..||||::.|||:..|.|||::....:.:.|:.| .:|:.|:  ..:|:||
Zfish  1600 VTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARNLYAHIQKL-TQPSAGETVTAMELEF 1663

  Fly  1192 EKLLATADEISKSCSVGENEENNMKNRSQEIIPYDRNRVILTPLPMRENSTYINASFIEGYDNSE 1256
            ::|..:....|:..| .....|..|||...|:|::..||.|.|:...|.|.|||||.|:||...:
Zfish  1664 KRLANSKAHTSRFIS-ANLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASCIDGYRQQK 1727

  Fly  1257 TFIIAQDPLENTIGDFWRMISEQSVTTLVMISEIGD-GPRKCPRYW-ADDEVQYDHILVKYVHSE 1319
            .:|..|.||..|..|||||:.|.:.|.:||::::.: |..||.:|| |:...:|.:.:|..:...
Zfish  1728 AYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEY 1792

  Fly  1320 SCPYYTRREFYVTNCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKNNKNSGCR 1384
            :.|.|..|||.||:.:...:..:.|||:..||  :..||:...|.|:.:.|.   :|..:..|..
Zfish  1793 NMPQYILREFKVTDARDGQSRTIRQFQFTDWP--EQGVPKTGEGFIDFIGQV---HKTKEQFGQD 1852

  Fly  1385 SPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCVDICATTRKLRSQRTGLINSYAQYEFLHRAIIN 1449
            .|:|||||.|..|:.:|:.:.|:::.:|.|..||:..|.:.||:||..::.:..||:..:||.:.
Zfish  1853 GPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALE 1917

  Fly  1450 Y 1450
            |
Zfish  1918 Y 1918

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ptp69DNP_524048.2 IG_like 139..233 CDD:214653 20/124 (16%)
Ig 150..221 CDD:143165 18/100 (18%)
fn3 237..321 CDD:278470 25/104 (24%)
FN3 339..432 CDD:238020 30/110 (27%)
FN3 439..535 CDD:238020 31/185 (17%)
PTPc 892..1155 CDD:214550 105/264 (40%)
PTPc 920..1155 CDD:238006 95/235 (40%)
PHA02694 <1121..1206 CDD:177476 30/87 (34%)
PTPc 1186..1449 CDD:214550 90/265 (34%)
PTPc 1216..1449 CDD:238006 83/235 (35%)
ptprfbXP_009296732.1 I-set 35..126 CDD:254352
Ig2_RPTP_IIa_LAR_like 155..233 CDD:319301
Ig3_RPTP_IIa_LAR_like 261..329 CDD:143216 22/93 (24%)
FN3 334..423 CDD:238020 7/89 (8%)
FN3 430..522 CDD:238020 20/100 (20%)
FN3 527..615 CDD:238020 24/98 (24%)
FN3 623..717 CDD:238020 5/94 (5%)
fn3 725..823 CDD:306538 28/108 (26%)
FN3 835..916 CDD:238020 14/87 (16%)
FN3 933..1021 CDD:238020 16/90 (18%)
PTPc 1397..1626 CDD:238006 95/236 (40%)
PTPc 1687..1917 CDD:238006 83/235 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.