DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ptp69D and PTPRE

Sequence 1:NP_524048.2 Gene:Ptp69D FlyBaseID:FBgn0014007 Length:1462 Species:Drosophila melanogaster
Sequence 2:XP_024303860.1 Gene:PTPRE HGNCID:9669 Length:731 Species:Homo sapiens

Alignment Length:685 Identity:227/686 (33%)
Similarity:365/686 (53%) Gaps:83/686 (12%)


  Fly   809 VLLGVILVFIVL----WVFHHKKTKN---------------ELQGEDTLTLRDSLSRALFGRRNH 854
            :||.::|:.:||    :.|..:|.:.               |.|.:..:.|   |||:       
Human    82 LLLPLLLLLLVLLLAAYFFRFRKQRKAVVSTSDKKMPNGILEEQEQQRVML---LSRS------- 136

  Fly   855 NHSHFITSGNHKGFDAGPIHRLDLENAYKNRHKDTDYGFLREYEMLPNRFSDRTTKNSDLKENAC 919
                  .||..|.|   ||....||...:.|..|....|..|:..||:.....|.:.::.:||..
Human   137 ------PSGPKKYF---PIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENRE 192

  Fly   920 KNRYPDIKAYDQTRVKLAVINGLQTTDYINANFVIGYKERKKFICAQGPMESTIDDFWRMIWEQH 984
            |||||:|...|.:||.|:.::|:..:|||||:::.||||:.|||.||||.:.|::|||||:|||.
Human   193 KNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQK 257

  Fly   985 LEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFGDILVKFAQERKTGDYIERTLNVSKN-----KA 1044
            ...|||||||:|..:.||.:|||::...|  :|:|.|.........||..|...:...     ||
Human   258 SATIVMLTNLKERKEEKCHQYWPDQGCWT--YGNIRVCVEDCVVLVDYTIRKFCIQPQLPDGCKA 320

  Fly  1045 NVGEEEDRRQITQYHYLTWKDFMAPEHPHGIIKFIRQINSVYSLQRGPILVHCSAGVGRTGTLVA 1109
                   .|.::|.|:.:|.||..|..|.|::||::::.::..:..|||:||||||||||||.:.
Human   321 -------PRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTGTFIV 378

  Fly  1110 LDSLIQQLEEEDSVSIYNTVCDLRHQRNFLVQSLKQYIFLYRALLDTGTFGNTDICIDTMASAIE 1174
            :|:::..:..|..|.::..|..:|:||..:||:..||.|:|:|||:...:|:|::.:.::...::
Human   379 IDAMMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLEKHLQ 443

  Fly  1175 SLKRKPNE-GKCKLEVEFEKLLATADEISK-SCSVGENEENNMKNRSQEIIPYDRNRVILTPLPM 1237
            ::...... .|..||.||.||  |...|.| :...|....|..|.|..:|||||.|||||:....
Human   444 TMHGTTTHFDKIGLEEEFRKL--TNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRG 506

  Fly  1238 RENSTYINASFIEGYDNSETFIIAQDPLENTIGDFWRMISEQSVTTLVMISEIGDGPR-KCPRYW 1301
            :|.:.|||||||:||...:.||..|.||.:|:.||||||.|....|:||::|:.:..: ||.:||
Human   507 QEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYW 571

  Fly  1302 -ADDEVQYDHILVKYVHSESCPYYTRREFYVT----NCKIDDTLKVT-QFQYNGWPTVDGEVPEV 1360
             .:..|.:..|.::..:.......:.|:|.||    ..:.::.::|. ||.::|||.:.  :|..
Human   572 PTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIG--IPAE 634

  Fly  1361 CRGIIELV-------DQAYNHYKNNKNSGCRSPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCVD 1418
            .:|:|:|:       .|..||           |:|||||.|..|:..|:|:..:::.::.|..:|
Human   635 GKGMIDLIAAVQKQQQQTGNH-----------PITVHCSAGAGRTGTFIALSNILERVKAEGLLD 688

  Fly  1419 ICATTRKLRSQRTGLINSYAQYEFLHRAIINYSDL 1453
            :....:.||.||..::.:..||||.::.:.::.|:
Human   689 VFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDI 723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ptp69DNP_524048.2 IG_like 139..233 CDD:214653
Ig 150..221 CDD:143165
fn3 237..321 CDD:278470
FN3 339..432 CDD:238020
FN3 439..535 CDD:238020
PTPc 892..1155 CDD:214550 107/268 (40%)
PTPc 920..1155 CDD:238006 100/240 (42%)
PHA02694 <1121..1206 CDD:177476 26/87 (30%)
PTPc 1186..1449 CDD:214550 93/278 (33%)
PTPc 1216..1449 CDD:238006 82/247 (33%)
PTPREXP_024303860.1 PTPc 165..424 CDD:214550 107/268 (40%)
PTPc 484..719 CDD:238006 82/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.