DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ptp69D and Lar

Sequence 1:NP_524048.2 Gene:Ptp69D FlyBaseID:FBgn0014007 Length:1462 Species:Drosophila melanogaster
Sequence 2:NP_001260594.1 Gene:Lar FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster

Alignment Length:1418 Identity:387/1419 (27%)
Similarity:619/1419 (44%) Gaps:293/1419 (21%)


  Fly   171 WLKDGSQFEFLDT--FSSISKLNDTHLNFTLEFTEVYKKENGTYKCTVFDDT--GLEITSKEITL 231
            :|.:..:|:.:||  |:......||  .::::...:.:|.:|.....:...|  |:.: ...::|
  Fly   761 FLNEPFKFDVVDTLEFNVTGLQPDT--KYSIQVAALTRKGDGDRSAAIVVKTPGGVPV-RPTVSL 822

  Fly   232 FVME-VPQVSIDF-----AKAVGANKIY-LNWTVNDGNDPIQKFFITLQEAGTPTFTYHKDFING 289
            .:|| .|.|||:.     |:..|..:.| |.|.|.|.         .|:|          :.::|
  Fly   823 KIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQ---------ALKE----------EMLSG 868

  Fly   290 SH-TSYILDHFKPNTTYFLRIVGKNSIGNGQPT----QYPQGITTLSYDPIFIPKVETTGSTAST 349
            .. |....|:.:....|..|:.|.|.||.||.|    |.|:|               |.|...|.
  Fly   869 PQMTKKRFDNLERGVEYEFRVAGSNHIGIGQETVKIFQTPEG---------------TPGGPPSN 918

  Fly   350 ITI----------GWNPPPPD-----LIDY-IQYYELIVSESGEVPKVIEEAIYQQNSRNL-PYM 397
            |||          .|:||..:     :..| :|::           |.|:..:..:.:..| ..:
  Fly   919 ITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFH-----------KKIDHGLGSERNMTLRKAV 972

  Fly   398 FDKLKTATDYEFRVRACSDLTKT-CGPWSENVNGTTMDGVATKPTNLSIQCHHDNVTRGNSIAIN 461
            |..|:..|:|.|||||   .||. .||:|:.:...|...:...|.:|..:     .|...:..|.
  Fly   973 FTNLEENTEYIFRVRA---YTKQGAGPFSDKLIVETERDMGRAPMSLQAE-----ATSEQTAEIW 1029

  Fly   462 WDVPKTPNGKVVSYLIHLLGNPMSTV-DREMWGPKIRRIDEPHHKTLYESVSPNTNYTVTVSAIT 525
            |: |.|..||::.|.|..   .|:.| |.:.|..|...:.|.......|..:   .|.|.::|  
  Fly  1030 WE-PVTSRGKLLGYKIFY---TMTAVEDLDDWQTKTVGLTESADLVNLEKFA---QYAVAIAA-- 1085

  Fly   526 RHKKNG-----EPATGSCLMPVSTP------DAIGRTM---WS-----------------KVNLD 559
             ..|||     |..|.. :.|...|      |....:|   ||                 ||.:|
  Fly  1086 -RFKNGLGRLSEKVTVR-IKPEDVPLNLRAHDVSTHSMTLSWSPPIRLTPVNYKISFDAMKVFVD 1148

  Fly   560 S------------KYVLKLYLP--KISERNGPICCYRLYLVRINNDNKELPDPEKLNIATYQEVH 610
            |            :.:||.|:.  .|:|.: |...|.:.:..|.:|....| |.|:.:.|.....
  Fly  1149 SQGFSQTQIVPKREIILKHYVKTHTINELS-PFTTYNVNVSAIPSDYSYRP-PTKITVTTQMAAP 1211

  Fly   611 SDNVTRSSAYIAEMISSKYFRPEIFLGDEKRFSENNDIIRDNDEICRKCLEGTPFLRKPEIIHIP 675
            ...|                :|:.:           .::  |.|               ||:.|.
  Fly  1212 QPMV----------------KPDFY-----------GVV--NGE---------------EILVIL 1232

  Fly   676 PQGSLSN---SDSELPILSE-KDNLIKGANLTEHALKILESKLRDKRNAVTSDENPILSAVNP-- 734
            ||.|...   |...|.::.| |.||.|..:      :.|...|...||.......|.::|..|  
  Fly  1233 PQASEEYGPISHYYLVVVPEDKSNLHKIPD------QFLTDDLLPGRNKPERPNAPYIAAKFPQR 1291

  Fly   735 NVP--LHDSSRDVF----DGEIDINSNYTGFLEIIVRDRNNALMAYSKYFDIIT----------- 782
            ::|  .|..|.|.:    :.:::....|..|:..:|......|...|.:.:.::           
  Fly  1292 SIPFTFHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKHLYTSSPFSEFLSLDMREAPPGER 1356

  Fly   783 -----PATEAEPIQSLN-NMD------YYLSIGVKAGAVLLGVILVFIVLWVFHHKKTKNELQGE 835
                 |...|||..|:| |.|      ..|.:.|....|...:|::.:|      |:.:...:..
  Fly  1357 PHRPDPNWPAEPEVSVNRNKDEPEILWVVLPLMVSTFIVSTALIVLCVV------KRRRQPCKTP 1415

  Fly   836 DTLTLRDSLSRALFG-----------RRNHNHSHFITSG--NHKGFDAGPIHRLDLENAYKNRHK 887
            |...:...|..|..|           ||    .:|.|.|  :|.     ||...:..|..:....
  Fly  1416 DQAAVTRPLMAADLGAGPTPSDPVDMRR----LNFQTPGMISHP-----PIPISEFANHIERLKS 1471

  Fly   888 DTDYGFLREYEML-PNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLAVINGLQTTDYINAN 951
            :.:..|.:|||.: |.:  ..|..||:|:.|..||||.::.|||.:||:|..:.|:..:||||||
  Fly  1472 NDNQKFSQEYESIEPGQ--QFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINAN 1534

  Fly   952 FVIGYKERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQF 1016
            :..||::...::..|||::.|..|||||.||.....|||:|.|||..:.||.:|||.:  .|:.:
  Fly  1535 YCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTR--GTETY 1597

  Fly  1017 GDILVKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLTWKDFMAPEHPHGIIKFIRQ 1081
            |.|.|...:.::...|..||..:.:...|     |||:|.|..:..|.|...|:||...::|:|:
  Fly  1598 GQIFVTITETQELATYSIRTFQLCRQGFN-----DRREIKQLQFTAWPDHGVPDHPAPFLQFLRR 1657

  Fly  1082 INSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVSIYNTVCDLRHQRNFLVQSLKQY 1146
            ..::...:.||::|||||||||||..:.:||::::::.|..:.||..|..||.|||::||:..||
  Fly  1658 CRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQY 1722

  Fly  1147 IFLYRALLDTGTFGNTDICIDTMASAIESLK-RKPNEGKCKLEVEFEKLLATADEISK------S 1204
            ||::.|:|:....|.|::....:.:.::.|. .:|.|....:||||:||.....:.||      .
  Fly  1723 IFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGETISGMEVEFKKLSNVKMDSSKFVTANLP 1787

  Fly  1205 CSVGENEENNMKNRSQEIIPYDRNRVILTPLPMRENSTYINASFIEGYDNSETFIIAQDPLENTI 1269
            |       |..|||...|:||:.:||.|||:...|.|.|:|||||:||.....:|.||.|:::..
  Fly  1788 C-------NKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAA 1845

  Fly  1270 GDFWRMISEQSVTTLVMISEIGD-GPRKCPRYWADD-EVQYDHILVKYVHSESCPYYTRREFYVT 1332
            .|||||:.|.:.|.:||::::.: |..||.:||..: .|:|.:.:|..:...:.|.|..|||.||
  Fly  1846 EDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVT 1910

  Fly  1333 NCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKNNKNSGCRSPLTVHCSLGTDR 1397
            :.:...:..|.|||:..||  :..||:...|.|:.:.|.   :|..:..|...|:|||||.|..|
  Fly  1911 DARDGSSRTVRQFQFIDWP--EQGVPKSGEGFIDFIGQV---HKTKEQFGQDGPITVHCSAGVGR 1970

  Fly  1398 SSIFVAMCILVQHLRLEKCVDICATTRKLRSQRTGLINSYAQYEFLHRAIINY 1450
            |.:|:.:.|:::.::.|..:|:..|.|.|||||..::.:..||.|.:||.:.|
  Fly  1971 SGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEY 2023

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ptp69DNP_524048.2 IG_like 139..233 CDD:214653 12/66 (18%)
Ig 150..221 CDD:143165 10/54 (19%)
fn3 237..321 CDD:278470 24/91 (26%)
FN3 339..432 CDD:238020 28/111 (25%)
FN3 439..535 CDD:238020 25/102 (25%)
PTPc 892..1155 CDD:214550 104/264 (39%)
PTPc 920..1155 CDD:238006 94/235 (40%)
PHA02694 <1121..1206 CDD:177476 30/92 (33%)
PTPc 1186..1449 CDD:214550 97/271 (36%)
PTPc 1216..1449 CDD:238006 87/235 (37%)
LarNP_001260594.1 Ig 35..129 CDD:299845
I-set 36..129 CDD:254352
IG_like 146..227 CDD:214653
Ig 159..228 CDD:299845
I-set 234..318 CDD:254352
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216
fn3 324..404 CDD:278470
FN3 423..514 CDD:238020
FN3 520..610 CDD:238020
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020 9/51 (18%)
FN3 832..907 CDD:238020 24/94 (26%)
FN3 914..1005 CDD:238020 26/105 (25%)
FN3 1012..1101 CDD:238020 26/104 (25%)
fn3 1106..1198 CDD:278470 18/93 (19%)
PTPc 1476..1731 CDD:214550 104/264 (39%)
PTPc 1503..1731 CDD:238006 94/235 (40%)
PTPc 1763..2022 CDD:214550 97/271 (36%)
PTPc 1791..2022 CDD:238006 87/236 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124032800
eggNOG 1 0.900 E2759_KOG4228
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19134
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.