DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ptp69D and Ptpre

Sequence 1:NP_524048.2 Gene:Ptp69D FlyBaseID:FBgn0014007 Length:1462 Species:Drosophila melanogaster
Sequence 2:NP_001303607.1 Gene:Ptpre MGIID:97813 Length:719 Species:Mus musculus

Alignment Length:674 Identity:223/675 (33%)
Similarity:361/675 (53%) Gaps:63/675 (9%)


  Fly   809 VLLGVILVFIVL--WVFHHKK------TKNELQGEDTLTLRDSLSRALFGRRNHNHSHFITSGNH 865
            :||.::|:..:|  :.|..:|      :.|:.:..:.:.......|.:...|:       .||..
Mouse    72 LLLPLLLLLFLLAAYFFRFRKQRKAVVSSNDKKMPNGILEEQEQQRVMLLSRS-------PSGPK 129

  Fly   866 KGFDAGPIHRLDLENAYKNRHKDTDYGFLREYEMLPNRFSDRTTKNSDLKENACKNRYPDIKAYD 930
            |.|   ||....||...:.|..|....|..|:..||:.....|.:.::.:||..|||||:|...|
Mouse   130 KFF---PIPVEHLEEEIRVRSADDCKRFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPND 191

  Fly   931 QTRVKLAVINGLQTTDYINANFVIGYKERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLE 995
            ..||.|:.::|:..:|||||:::.||||:.|||.||||.:.|::|||||:|||....|||||||:
Mouse   192 HCRVILSQVDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQRSATIVMLTNLK 256

  Fly   996 EYNKAKCAKYWPEKVFDTKQFGDILVKFAQERKTGDYIERTLNVSKN-----KANVGEEEDRRQI 1055
            |..:.||.:|||::...|  :|:|.|.........||..|...:...     ||       .|.:
Mouse   257 ERKEEKCYQYWPDQGCWT--YGNIRVCVEDCVVLVDYTIRKFCIHPQLPDSCKA-------PRLV 312

  Fly  1056 TQYHYLTWKDFMAPEHPHGIIKFIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEE 1120
            :|.|:.:|.||..|..|.|::||::::.::.....|||:||||||||||||.:.:|:::..:..|
Mouse   313 SQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPSHAGPIVVHCSAGVGRTGTFIVIDAMMDMIHSE 377

  Fly  1121 DSVSIYNTVCDLRHQRNFLVQSLKQYIFLYRALLDTGTFGNTDICIDTMASAIESLKRKPNE-GK 1184
            ..|.::..|..:|:||..:||:..||.|:|:|||:...:|:|::.:.::...:::|...... .|
Mouse   378 QKVDVFEFVSRIRNQRPQMVQTDVQYTFIYQALLEYYLYGDTELDVSSLERHLQTLHSTATHFDK 442

  Fly  1185 CKLEVEFEKLLATADEISK-SCSVGENEENNMKNRSQEIIPYDRNRVILTPLPMRENSTYINASF 1248
            ..||.||.||  |...|.| :...|....|..|.|..:|||||.|||||:....:|.:.||||||
Mouse   443 IGLEEEFRKL--TNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEFTDYINASF 505

  Fly  1249 IEGYDNSETFIIAQDPLENTIGDFWRMISEQSVTTLVMISEIGDGPR-KCPRYW-ADDEVQYDHI 1311
            |:||...:.|:..|.||.:|:.|||||:.|....|:||::|:.:..: ||.:|| .:..|.:..|
Mouse   506 IDGYRQKDYFMATQGPLAHTVEDFWRMVWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGDI 570

  Fly  1312 LVKYVHSESCPYYTRREFYVT----NCKIDDTLK-VTQFQYNGWPTVDGEVPEVCRGIIELV--- 1368
            .::..........:.|:|.||    ..:.::.:: |.||.::|||.|.  :|...:|:|:|:   
Mouse   571 TIEIKSDTLSEAISVRDFLVTFKQPLARQEEQVRMVRQFHFHGWPEVG--IPAEGKGMIDLIAAV 633

  Fly  1369 ----DQAYNHYKNNKNSGCRSPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCVDICATTRKLRSQ 1429
                .|..||           |:|||||.|..|:..|:|:..:::.::.|..:|:....:.||.|
Mouse   634 QKQQQQTGNH-----------PITVHCSAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQ 687

  Fly  1430 RTGLINSYAQYEFLHRAIINYSDL 1453
            |..::.:..||||.::.:.::.|:
Mouse   688 RPHMVQTLEQYEFCYKVVQDFIDI 711

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ptp69DNP_524048.2 IG_like 139..233 CDD:214653
Ig 150..221 CDD:143165
fn3 237..321 CDD:278470
FN3 339..432 CDD:238020
FN3 439..535 CDD:238020
PTPc 892..1155 CDD:214550 107/268 (40%)
PTPc 920..1155 CDD:238006 100/240 (42%)
PHA02694 <1121..1206 CDD:177476 27/87 (31%)
PTPc 1186..1449 CDD:214550 92/278 (33%)
PTPc 1216..1449 CDD:238006 81/247 (33%)
PtpreNP_001303607.1 PTPc 154..412 CDD:214550 107/267 (40%)
PTPc 180..412 CDD:238006 100/241 (41%)
PTPc 444..707 CDD:214550 92/278 (33%)
PTPc 472..707 CDD:238006 81/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.