DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pmm2 and SEC53

DIOPT Version :8

Sequence 1:NP_648589.1 Gene:Pmm2 / 39436 FlyBaseID:FBgn0036300 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_116609.1 Gene:SEC53 / 850499 SGDID:S000001849 Length:254 Species:Saccharomyces cerevisiae

Alignment Length:248 Identity:142/249 (57%)
Similarity:177/249 (71%) Gaps:3/249 (1%)


  Fly     7 KRDEILLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQLNGRKILNEFD 71
            ::.|.|:|||||||||..|..|:.|..:.. ::::.:..||.||||||.|..||| |..:|:|||
Yeast    10 EKPETLVLFDVDGTLTPARLTVSEEVRKTL-AKLRNKCCIGFVGGSDLSKQLEQL-GPNVLDEFD 72

  Fly    72 FIFPENGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPIKRGTFIEFRNGMMNVC 136
            :.|.||||.....|||:..|:.|..||||...:...|:||||||:|:|.:||||:||||||:||.
Yeast    73 YSFSENGLTAYRLGKELASQSFINWLGEEKYNKLAVFILRYLSEIDLPKRRGTFLEFRNGMINVS 137

  Fly   137 PIGRQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGWDKTYCLRH 201
            ||||..:.||||.|..||.||::|.|.::.||:||.|..||:||||||||||||.||||||||:|
Yeast   138 PIGRNASTEERNEFERYDKEHQIRAKFVEALKKEFPDYGLTFSIGGQISFDVFPAGWDKTYCLQH 202

  Fly   202 IEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEILEL 254
            :|.. .|||||||||||..|||||||:.|.|||.|.|.:|.||.:||||:..|
Yeast   203 VEKD-GFKEIHFFGDKTMVGGNDYEIFVDERTIGHSVQSPDDTVKILTELFNL 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmm2NP_648589.1 HAD-SF-IIB 12..234 CDD:273651 130/222 (59%)
PMM 33..254 CDD:281343 127/221 (57%)
SEC53NP_116609.1 PMM 36..254 CDD:281343 127/221 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249531480
eggNOG 1 0.900 E1_COG0561
Hieranoid 1 1.000
Homologene 1 1.000 H257
Inparanoid 1 1.050 280 1.000 Inparanoid score I555
Isobase 1 0.950 0 Normalized mean entropy S364
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002039
OrthoInspector 1 1.000 T1136686
orthoMCL 1 0.900 OOG5_127648
Panther 1 1.100 LDO PTHR10466
Phylome 1 0.910 0.985 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R935
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.