DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pmm2 and pmm2

DIOPT Version :8

Sequence 1:NP_648589.1 Gene:Pmm2 / 39436 FlyBaseID:FBgn0036300 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_956378.1 Gene:pmm2 / 368229 ZFINID:ZDB-GENE-030722-6 Length:250 Species:Danio rerio

Alignment Length:240 Identity:136/240 - (56%)
Similarity:171/240 - (71%) Gaps:3/240 - (1%)


  Fly    12 LLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQLNGRKILNEFDFIFPE 76
            |.|||||||||..|...|.:..||. |::|.|..:|:||||||:|:.||| |..:::..|::|.|
Zfish    11 LCLFDVDGTLTAARQKATADMHEFL-SKLKQRVKVGVVGGSDLDKIKEQL-GDDVIDRVDYVFAE 73

  Fly    77 NGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPIKRGTFIEFRNGMMNVCPIGRQ 141
            ||||....||....|||..:|||:.::.||||.|.|||::.:|.||||||||||||:||.||||.
Zfish    74 NGLVAYRFGKLHSVQNIQAYLGEDILQEFINFCLNYLSKIKLPKKRGTFIEFRNGMLNVSPIGRS 138

  Fly   142 CTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGWDKTYCLRHIEAHY 206
            |:::||..|.|.|.:.|:||..:..||:|||...|.:||||||||||||.||||.|||..:|.. 
Zfish   139 CSQQERIEFFELDKKEKIRETFVSVLKEEFAGKGLAFSIGGQISFDVFPEGWDKRYCLGIVEKD- 202

  Fly   207 KFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEI 251
            .::.||||||||.||||||||:.|||||.|.|.:|:|||||..|:
Zfish   203 SYQHIHFFGDKTMPGGNDYEIFVDPRTIGHEVKSPEDTQRICREL 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmm2NP_648589.1 HAD-SF-IIB 12..234 CDD:273651 125/221 (57%)
PMM 33..254 CDD:281343 124/219 (57%)
pmm2NP_956378.1 PTZ00174 10..249 CDD:240305 136/240 (57%)
HAD-SF-IIB 13..232 CDD:273651 126/221 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249486310
eggNOG 1 0.900 E1_COG0561
Hieranoid 1 1.000
Homologene 1 1.000 H257
Inparanoid 1 1.050 269 1.000 Inparanoid score I2929
OMA 1 1.010
OrthoDB 1 1.010 D1038583at2759
OrthoFinder 1 1.000 FOG0002039
OrthoInspector 1 1.000 T1054145
orthoMCL 1 0.900 OOG5_127648
Panther 1 1.100 LDO PTHR10466
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R935
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.