DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pmm2 and Pmm1

DIOPT Version :8

Sequence 1:NP_648589.1 Gene:Pmm2 / 39436 FlyBaseID:FBgn0036300 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001008324.1 Gene:Pmm1 / 300089 RGDID:1310897 Length:262 Species:Rattus norvegicus

Alignment Length:248 Identity:130/249 (52%)
Similarity:172/249 (69%) Gaps:3/249 (1%)


  Fly     5 ALKRDEILLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQL-NGRKILN 68
            |.:::.||.|||||||||..|..:.||...|. .:::.|..||:|||||..|:.||| :|.:::.
  Rat     8 ARRKERILCLFDVDGTLTPARQKIDPEVSAFL-QKLRSRVQIGVVGGSDYSKIAEQLGDGDEVIE 71

  Fly    69 EFDFIFPENGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPIKRGTFIEFRNGMM 133
            :||::|.|||.||.:.|:.:.||.|..|||||.::..|||.|.|::.|.:|.||||||||||||:
  Rat    72 KFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGML 136

  Fly   134 NVCPIGRQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGWDKTYC 198
            |:.||||.||.|||..|:|.|.:.|:|||.:..||.|||...|.:|.||.|||||||.||||.||
  Rat   137 NISPIGRSCTLEERIEFSELDKKEKIREKFVAALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYC 201

  Fly   199 LRHIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEI 251
            |..::.. .|..|||||::|.|||||:|||:||||:.|.|.:|:||.:...|:
  Rat   202 LDSLDED-SFDIIHFFGNETSPGGNDFEIYADPRTVGHSVVSPQDTVQRCREL 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmm2NP_648589.1 HAD-SF-IIB 12..234 CDD:273651 122/223 (55%)
PMM 33..254 CDD:281343 115/221 (52%)
Pmm1NP_001008324.1 HAD-SF-IIB 17..238 CDD:273651 121/223 (54%)
PMM 37..256 CDD:281343 115/220 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249484925
eggNOG 1 0.900 E1_COG0561
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I2831
OMA 1 1.010
OrthoDB 1 1.010 D1038583at2759
OrthoFinder 1 1.000 FOG0002039
OrthoInspector 1 1.000 T619002
orthoMCL 1 0.900 OOG5_127648
Panther 1 1.100 O PTHR10466
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.