DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pmm2 and pmm2

DIOPT Version :8

Sequence 1:NP_648589.1 Gene:Pmm2 / 39436 FlyBaseID:FBgn0036300 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001135677.1 Gene:pmm2 / 100216238 XenbaseID:XB-GENE-998969 Length:260 Species:Xenopus tropicalis

Alignment Length:246 Identity:130/247 (53%)
Similarity:171/247 (69%) Gaps:3/247 (1%)


  Fly     7 KRDEILLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQL-NGRKILNEF 70
            |..:||.|||||||||..|..|.|..::|. ..::.|..||:|||||..|:.||| .|.:::::|
 Frog     8 KHRDILCLFDVDGTLTPAREKVDPAVDQFL-QELRQRVKIGVVGGSDYSKIAEQLGEGDQVVSKF 71

  Fly    71 DFIFPENGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPIKRGTFIEFRNGMMNV 135
            |:||.|||.||.:.||.:.:|.|..|||||.::..|||.|.|::.|.:|.||||||||||||:|:
 Frog    72 DYIFAENGTVQYKDGKLLARQAIQNHLGEELLQDLINFCLMYIALLKLPKKRGTFIEFRNGMLNI 136

  Fly   136 CPIGRQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGWDKTYCLR 200
            .||||.||:|||..|.|.|.:.::|||.:..|::|||...|.::.||.||||:||.||||..||.
 Frog   137 SPIGRSCTQEERIEFNELDKKERIREKFVAALQREFAGKGLRFTRGGMISFDIFPEGWDKRCCLE 201

  Fly   201 HIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEI 251
            .:.|. :|..|||||::|.|||||||||||||||.|.|.:|:||.:...|:
 Frog   202 VLAAE-QFSSIHFFGNETTPGGNDYEIYSDPRTIGHTVVSPEDTVKRCQEL 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmm2NP_648589.1 HAD-SF-IIB 12..234 CDD:273651 121/223 (54%)
PMM 33..254 CDD:281343 115/221 (52%)
pmm2NP_001135677.1 HAD-SF-IIB 15..236 CDD:273651 121/223 (54%)
PMM 34..254 CDD:281343 115/221 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249485340
eggNOG 1 0.900 E1_COG0561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1038583at2759
OrthoFinder 1 1.000 FOG0002039
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.