DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pmm2 and LOC100007686

DIOPT Version :8

Sequence 1:NP_648589.1 Gene:Pmm2 / 39436 FlyBaseID:FBgn0036300 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_003198076.3 Gene:LOC100007686 / 100007686 -ID:- Length:271 Species:Danio rerio

Alignment Length:242 Identity:121/243 (50%)
Similarity:164/243 (67%) Gaps:3/243 (1%)


  Fly    11 ILLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQL-NGRKILNEFDFIF 74
            :|.|||||||||.||..:.||.::|..: :|.:..||:|||||..|:.||| :|.:::.:||::|
Zfish    23 VLCLFDVDGTLTAPREKIDPELDDFIQA-LKQKVKIGVVGGSDYCKIAEQLGDGDEVIQKFDYVF 86

  Fly    75 PENGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPIKRGTFIEFRNGMMNVCPIG 139
            .|||.||.:.||.:.||.|..|||||.::..|||.|.|:..:.:|.|||||||||:|::|:.|||
Zfish    87 AENGTVQYKDGKLIFKQAIQNHLGEELLQELINFCLSYMGLIKLPKKRGTFIEFRSGVINISPIG 151

  Fly   140 RQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGWDKTYCLRHIEA 204
            |.||.|||..|:|.|...|:|||.:..|::|||...|.::.||.||||:||.||||..||..:|.
Zfish   152 RSCTLEERIEFSEIDKREKIREKFVAALQKEFAGKGLRFTRGGLISFDIFPEGWDKRLCLDVLEQ 216

  Fly   205 HYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEI 251
            . ....|:|||::|..|||||||:.||||:...|..|.||.|:..|:
Zfish   217 E-GLDTIYFFGNETSLGGNDYEIFEDPRTVGFSVSCPADTARLCREM 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmm2NP_648589.1 HAD-SF-IIB 12..234 CDD:273651 115/223 (52%)
PMM 33..254 CDD:281343 107/221 (48%)
LOC100007686XP_003198076.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249485574
eggNOG 1 0.900 E1_COG0561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1038583at2759
OrthoFinder 1 1.000 FOG0002039
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127648
Panther 1 1.100 O PTHR10466
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.