DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pmm2 and LOC100007686

DIOPT Version :9

Sequence 1:NP_648589.1 Gene:Pmm2 / 39436 FlyBaseID:FBgn0036300 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_003198076.3 Gene:LOC100007686 / 100007686 -ID:- Length:271 Species:Danio rerio


Alignment Length:242 Identity:121/242 - (50%)
Similarity:164/242 - (67%) Gaps:3/242 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQL-NGRKILNEFDFIF 74
            :|.|||||||||.||..:.||.::|..: :|.:..||:|||||..|:.||| :|.:::.:||::|
Zfish    23 VLCLFDVDGTLTAPREKIDPELDDFIQA-LKQKVKIGVVGGSDYCKIAEQLGDGDEVIQKFDYVF 86

  Fly    75 PENGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPIKRGTFIEFRNGMMNVCPIG 139
            .|||.||.:.||.:.||.|..|||||.::..|||.|.|:..:.:|.|||||||||:|::|:.|||
Zfish    87 AENGTVQYKDGKLIFKQAIQNHLGEELLQELINFCLSYMGLIKLPKKRGTFIEFRSGVINISPIG 151

  Fly   140 RQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGWDKTYCLRHIEA 204
            |.||.|||..|:|.|...|:|||.:..|::|||...|.::.||.||||:||.||||..||..:|.
Zfish   152 RSCTLEERIEFSEIDKREKIREKFVAALQKEFAGKGLRFTRGGLISFDIFPEGWDKRLCLDVLEQ 216

  Fly   205 HYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEI 251
            . ....|:|||::|..|||||||:.||||:...|..|.||.|:..|:
Zfish   217 E-GLDTIYFFGNETSLGGNDYEIFEDPRTVGFSVSCPADTARLCREM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pmm2NP_648589.1 HAD-SF-IIB 12..234 CDD:273651 114/222 (51%)
PMM 33..254 CDD:281343 107/220 (49%)
LOC100007686XP_003198076.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53697
OrthoDB 1 1.010 - - D1038583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101634
Panther 1 1.100 - - O PTHR10466
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.