DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2beta and Eif2s2

DIOPT Version :8

Sequence 1:NP_524043.1 Gene:eIF2beta / 39433 FlyBaseID:FBgn0004926 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_955412.1 Gene:Eif2s2 / 296302 RGDID:735192 Length:333 Species:Rattus norvegicus

Alignment Length:338 Identity:197/339 (58%)
Similarity:230/339 (68%) Gaps:48/339 (14%)


  Fly     7 FDPTLLKKKKKKKTTFDLDAALGLEDDTKKE------------DPQDEASAEGGAAAEEDNL--- 56
            ||||:.|||||||..|.||.    |.|.:.|            :|.:|...|   |.|||:.   
  Rat     8 FDPTMSKKKKKKKKPFMLDE----EGDAQTEETQPSETKEVEPEPAEEKDVE---ADEEDSRKKD 65

  Fly    57 ------DLESFGKKKKKK--KKPFNMDEIEAAIPSFGGDDV---AASEEPEEEEINLDMDFSMAK 110
                  ||..|.:|||||  ||.|::||.|.||     .||   :.::||.|.|.:||:.....|
  Rat    66 ASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEAI-----KDVKIESDAQEPAEPEDDLDIMLGNKK 125

  Fly   111 KKKKSKK-KELDELF-ADQADDDKSEDKENDE------DNSSTWFGSDRDYTYDELLKRVFEIIL 167
            ||||:.| .:.||:. .|:|.:|  ||.:.|:      .....|.||:|||||:|||.|||.|:.
  Rat   126 KKKKNVKFPDEDEILEKDEALED--EDSKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMR 188

  Fly   168 DKNPDMAAGRKPKFVMRPPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGN 232
            :|||||.||.|.||||:||||:|||||||||.||.||.|.|||.|||||.|||||||||||:|||
  Rat   189 EKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGN 253

  Fly   233 QQLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASIKSGF 297
            .||:||||||.|||||||||||||||||||||||:|||||||||:|||||:|.|||||||||:||
  Rat   254 NQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGF 318

  Fly   298 QAVTGKRAAIRAK 310
            ||||||||.:|||
  Rat   319 QAVTGKRAQLRAK 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF2betaNP_524043.1 eIF2B_5 178..287 CDD:214764 92/109 (84%)
Eif2s2NP_955412.1 eIF2B_5 199..308 CDD:214764 92/109 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159305084
eggNOG 1 0.900 E1_COG1601
Hieranoid 1 1.000
Homologene 1 1.000 H2904
Inparanoid 1 1.050 340 1.000 Inparanoid score I2258
OMA 1 1.010
OrthoDB 1 1.010 D1178655at2759
OrthoFinder 1 1.000 FOG0003981
OrthoInspector 1 1.000 T1086328
orthoMCL 1 0.900 OOG5_127339
Panther 1 1.100 LDO PTHR23001
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.