| Sequence 1: | NP_001261768.1 | Gene: | sti / 39429 | FlyBaseID: | FBgn0002466 | Length: | 1858 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_010015.3 | Gene: | KIN82 / 850453 | SGDID: | S000000687 | Length: | 720 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 523 | Identity: | 151/523 - (28%) |
|---|---|---|---|
| Similarity: | 251/523 - (47%) | Gaps: | 131/523 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 AKPAGSASGSGIP-------ASTRRSIVPVSTT---SAAVAEAI--CREGLL--DAFCLLYNECD 78
Fly 79 KDTLK-KRDRNI--AEFVNKFRPIIEETR---KLRVNADDFLIKTLIGQGYFGNVHLVVERQTND 137
Fly 138 IYAMKKIKK-SVVTTSQVKE---ERDIMSIRNSEWLINLQYAFQDNDNLYLVMEYMPGGDLL-SL 197
Fly 198 MSRHGP-FDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLADF-------GNA 254
Fly 255 AALDRDGHVLSL----------SPVGTPDYIAPELLQTISTYKLSKSMHDVSRIVSCDYWSMGII 309
Fly 310 GYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRNLIESLVT-NPSKRLS 373
Fly 374 YER----IKNHPFFSEIPWGSIRSQVPPIIPTVRSDDDTSNFEDGIRHKTRREQGVAKKSLTTNM 434
Fly 435 KSNDFSGKDLPFIGYSFVHMEKSAISATTDEKLQEKLKELLQKLKTRE-----------NEISML 488
Fly 489 KQD 491 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sti | NP_001261768.1 | PKc_like | 111..452 | CDD:304357 | 117/368 (32%) |
| S_TKc | 113..383 | CDD:214567 | 101/297 (34%) | ||
| Smc | 487..1222 | CDD:224117 | 2/5 (40%) | ||
| CNH | 1503..1774 | CDD:279162 | |||
| KIN82 | NP_010015.3 | STKc_phototropin_like | 322..623 | CDD:270726 | 112/364 (31%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||