DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and PRKX

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_005035.1 Gene:PRKX / 5613 HGNCID:9441 Length:358 Species:Homo sapiens


Alignment Length:314 Identity:116/314 - (36%)
Similarity:169/314 - (53%) Gaps:40/314 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 DFLIKTLIGQGYFGNVHLVVERQTNDIYAMKKIK-KSVVTTSQ---VKEERDIMSIRNSEWLINL 172
            ||.....:|.|.||.||||.|:.....:|:|.:. ..|:...|   |..|:.::...:..:||.|
Human    48 DFDTLATVGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRL 112

  Fly   173 QYAFQDNDNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPEN 237
            .:.:.|...||::|||:|||:|.|.:...|.|......||.||:..|:..||....|:||:||||
Human   113 FWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPEN 177

  Fly   238 ILIDRFGHIKLADFGNAAAL-DRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSRIVSC 301
            ||:||.|||||.|||.|..| ||     :.:..|||:|:|||::|       ||. |  .|.|  
Human   178 ILLDRDGHIKLTDFGFAKKLVDR-----TWTLCGTPEYLAPEVIQ-------SKG-H--GRAV-- 225

  Fly   302 DYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRNLIES-LV 365
            |:|::||:.:|::....||.:||....|.|||:        ..|.||..|...|  ::||:. ||
Human   226 DWWALGILIFEMLSGFPPFFDDNPFGIYQKILA--------GKIDFPRHLDFHV--KDLIKKLLV 280

  Fly   366 TNPSKRLSYER-----IKNHPFFSEIPWGSI--RSQVPPIIPTVRSDDDTSNFE 412
            .:.::||...:     :|:|.:|..:.|.::  |...|||:|.:..|.||||||
Human   281 VDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFE 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 116/314 (37%)
S_TKc 113..383 CDD:214567 101/280 (36%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
PRKXNP_005035.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
PTZ00263 39..358 CDD:140289 116/314 (37%)
STKc_PRKX_like 47..338 CDD:270763 116/314 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.