DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and PRKACG

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_002723.2 Gene:PRKACG / 5568 HGNCID:9382 Length:351 Species:Homo sapiens


Alignment Length:373 Identity:125/373 - (33%)
Similarity:198/373 - (53%) Gaps:62/373 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KDTLKKRDRNIAEFVNKFR---------PIIEETRKLRVNADDFLIKTLIGQGYFGNVHLVVERQ 134
            |||  :::.::.||:.|.|         | .:.|    .::|.|.....:|.|.||.|.||..::
Human     8 KDT--EQEESVNEFLAKARGDFLYRWGNP-AQNT----ASSDQFERLRTLGMGSFGRVMLVRHQE 65

  Fly   135 TNDIYAMKKI-KKSVVTTSQVK---EERDIMSIRNSEWLINLQYAFQDNDNLYLVMEYMPGGDLL 195
            |...||||.: |:.||...||:   .|:.|:...:..:|:.||::|:||..|||||||:|||::.
Human    66 TGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMF 130

  Fly   196 SLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLADFGNAAALDRD 260
            |.:.|.|.|.|..|.||.|::.:|:..||.:..:|||:||||:|||:.|::::.|||.|..:  .
Human   131 SRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRV--K 193

  Fly   261 GHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSRIVSCDYWSMGIIGYELICETTPFHEDNV 325
            |...:|  .|||:|:|||::       |||..:.     :.|:|::|::.||:.....||:.|..
Human   194 GRTWTL--CGTPEYLAPEII-------LSKGYNK-----AVDWWALGVLIYEMAVGFPPFYADQP 244

  Fly   326 HETYSKILSHCEESHLKELISFPADLKVSVNYRNLIESLV-TNPSKRLSYER-----IKNHPFFS 384
            .:.|.||:|        ..:.||:  |:|.:.::|:.||: .:.:||....|     ||||.:|:
Human   245 IQIYEKIVS--------GRVRFPS--KLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFA 299

  Fly   385 EIPWGSI--RSQVPPIIPTVRSDDDTSNFED--------GIRHKTRRE 422
            ...|.:|  :....|.||......|.|||:|        .|..|..:|
Human   300 TTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKE 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 116/332 (35%)
S_TKc 113..383 CDD:214567 101/279 (36%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
PRKACGNP_002723.2 PTZ00426 36..351 CDD:173616 117/342 (34%)
STKc_PKA 42..331 CDD:271111 112/314 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.