DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and stac3

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_001007507.1 Gene:stac3 / 493233 XenbaseID:XB-GENE-5903818 Length:337 Species:Xenopus tropicalis


Alignment Length:113 Identity:31/113 - (27%)
Similarity:50/113 - (44%) Gaps:20/113 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1327 SPRKSAAVNGDSDAPKQRPVSIAALPRSPQKQQQPLKRTTSQVELKTTAEKPTKVTIENQAHHRF 1391
            ||...|..||  :.|...|: |..:..|.:::::.        |.:...|.|..|   |...|:|
 Frog    12 SPVPDAQQNG--ELPNSGPI-IYYIYESEEEEEEE--------EEEPPPEPPRPV---NDKPHKF 62

  Fly  1392 -ELALQESKVDAVNCVVCEKAVVAGSPF-WKCKECKDVTHRKCRSNVQ 1437
             :..|::.|.    |.||.:.:|..:.| .:||.||...|..|:|.|:
 Frog    63 KDHYLKKPKF----CDVCARMIVLNNKFGLRCKNCKTNIHHHCQSYVE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357
S_TKc 113..383 CDD:214567
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
stac3NP_001007507.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61 14/62 (23%)
C1_1 60..105 CDD:365894 16/48 (33%)
STAC2_u1 117..>165 CDD:374707
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..215
SH3 224..276 CDD:388381
SH3_Stac_2 283..333 CDD:212768
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.