DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and PKD

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_001262705.1 Gene:PKD / 42203 FlyBaseID:FBgn0038603 Length:906 Species:Drosophila melanogaster


Alignment Length:390 Identity:99/390 - (25%)
Similarity:165/390 - (42%) Gaps:88/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RLNNL--ILGKGAGVCAK--------PAGSASGSGI----PASTRRSIVPVSTTSAAVAEAICRE 64
            ||.||  .:|:...|.||        |..|..||.|    ..|.|::.:.|:.|....:|     
  Fly   472 RLPNLSYFVGQDPQVGAKEEQAVRLPPPDSGIGSDIAKSWETSIRQAFMHVTNTQCCESE----- 531

  Fly    65 GLLDAFCLLYNECDKDTLKKRDRNIAEFVNKFRPIIEETRKLRVNADDFLIKTLIGQGYFGNVHL 129
                                  ..:.:....::...:|               ::|.|.||.|:.
  Fly   532 ----------------------EQVQDMGQLYQIFPDE---------------VLGSGQFGVVYG 559

  Fly   130 VVERQTNDIYAMKKIKKSVVTT---SQVKEERDIMSIRNSEWLINLQYAFQDNDNLYLVMEYMPG 191
            .|.::|....|:|.|.|....|   :|:|.|..|:...:...::||:..|:..:.:::|||.:. 
  Fly   560 GVHKKTQREVAIKVIDKLRFPTKQEAQLKNEVAILQNISHCGVVNLERMFETPERIFVVMEKLK- 623

  Fly   192 GDLLSLMSRH--GPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILID---RFGHIKLADF 251
            ||:|.::..|  |...|.:.:|.:.::.:||..||....||.|:||||:|:.   .|..:||.||
  Fly   624 GDMLEMILSHARGRLSERVTKFLITQILIALKYLHSQNIVHCDLKPENVLLSSDAEFPQVKLCDF 688

  Fly   252 GNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSRIVSCDYWSMGIIGYELICE 316
            |.|..:....  ...|.||||.|:|||:|:.....:            |.|.||:|:|.|..:..
  Fly   689 GYARIIGEKS--FRRSVVGTPAYLAPEVLRNKGYNR------------SLDMWSVGVIIYVSLSG 739

  Fly   317 TTPFH-EDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRNLIESLVTNPSKRLSYERIKNH 380
            |.||: |:::::...........:..||:.|...||   :|  ||::   ....||.:.::...|
  Fly   740 TFPFNEEEDINDQIQNAAFMYPPNPWKEISSNAIDL---IN--NLLQ---VKQRKRYTVDKSLLH 796

  Fly   381  380
              Fly   797  796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 80/279 (29%)
S_TKc 113..383 CDD:214567 80/277 (29%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
PKDNP_001262705.1 C1_1 109..154 CDD:278556
C1 223..272 CDD:197519
PH_PKD 396..522 CDD:269945 15/49 (31%)
STKc_PKD 539..798 CDD:270984 81/296 (27%)
S_TKc 547..799 CDD:214567 81/288 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.