DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and wor

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster


Alignment Length:418 Identity:81/418 - (19%)
Similarity:139/418 - (33%) Gaps:167/418 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DSEQDLASKYYGCTGEDAVRDLPPQLV-------------------LKSICECCYQLVQKFHDFQ 102
            :.||.|..:|        .||..|.::                   ||||.|        :.|..
  Fly   129 EPEQHLPLRY--------TRDASPTIIKAEPSDEEQFPLRNYNNNLLKSIAE--------YEDCM 177

  Fly   103 RMCAESLRNFEKLLQDIDIGCHKLEDHTWHDLDTPSESNE----------STNPEAQSHAPCIAA 157
            :|     :|.::.:..|.      ....::...||....|          |.|...|:.|..:.:
  Fly   178 KM-----QNIKEEIPPIP------SPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARALLS 231

  Fly   158 TQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGV 222
            .|.:.    ||...|                 ...:|::...||:.|.|:..|:.|.        
  Fly   232 MQHMA----PQHAPP-----------------PIDMEEDQENQDINQLKIKSSNDLY-------- 267

  Fly   223 RHTLECRICHRGF-------------------YK-----------------------PSLLEA-- 243
               .:|:.|::.:                   ||                       .:|::|  
  Fly   268 ---YQCQQCNKCYATYAGLVKHQQTHAYESTEYKIIRSQPGGSGAIVDQTEFCTDQASALIQAAN 329

  Fly   244 -----HMQQHEGLRPYTCVHCAKSYARANLLESHLRQMH-NNADAARI--IYACPSCNKVYTANR 300
                 .||:..|:..|.|..|.|||:..:.|..| :|.| .:|:..::  :::|.:|:|.|.:..
  Fly   330 VASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKH-QQFHCPSAEGNQVKKVFSCKNCDKTYVSLG 393

  Fly   301 SLKYHMR---------------------RTHERYHESESPDARHICEECGKCFARKAHLTRHKMV 344
            :||.|:|                     :.|.|.|..|.|.:   |:.|.:.||.:::|..|...
  Fly   394 ALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFS---CQHCNRAFADRSNLRAHMQT 455

  Fly   345 HGSVEGRRYCCECCDRRFYTKENMVDHL 372
            |..|  ::|.|..|.:.|.....:..||
  Fly   456 HSDV--KKYSCPTCTKSFSRMSLLAKHL 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 15/76 (20%)
C2H2 Zn finger 228..248 CDD:275368 8/68 (12%)
C2H2 Zn finger 256..313 CDD:275368 19/80 (24%)
C2H2 Zn finger 289..314 CDD:275368 10/45 (22%)
zf-C2H2 323..345 CDD:278523 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 355..376 CDD:275368 5/18 (28%)
C2H2 Zn finger 385..405 CDD:275368
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 2/19 (11%)
C2H2 Zn finger 317..334 CDD:275368 2/16 (13%)
zf-C2H2 345..367 CDD:278523 9/22 (41%)
C2H2 Zn finger 347..367 CDD:275368 8/20 (40%)
PHA00732 379..>417 CDD:177300 8/37 (22%)
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
zf-C2H2_8 405..482 CDD:292531 19/82 (23%)
zf-C2H2 406..428 CDD:278523 2/21 (10%)
C2H2 Zn finger 408..428 CDD:275368 2/19 (11%)
zf-H2C2_2 421..444 CDD:290200 7/25 (28%)
zf-C2H2 434..456 CDD:278523 6/24 (25%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
zf-H2C2_2 448..473 CDD:290200 8/26 (31%)
C2H2 Zn finger 464..481 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.