DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10638 and CG2767

Sequence 1:NP_001287050.1 Gene:CG10638 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster

Alignment Length:322 Identity:130/323 (40%)
Similarity:192/323 (59%) Gaps:18/323 (6%)


  Fly    10 NNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKRED 74
            |||.:||::|:||:.:.|.|.|.|:..|::.||||||||..|.||..:|:.::..:..|.||||:
  Fly    10 NNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREE 74

  Fly    75 IFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSD 139
            :|:|||:..:.:.|..||...:|.|.:..|||:||||:|.|......:|.:.  |.:.:.|...|
  Fly    75 LFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSF--KLDKEGLMEVD 137

  Fly   140 V--DYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKALTAFC 202
            |  ::...:.|||.||:.||.:|||||||:.:|:||:|.||:|:|..||:|....|.|:.|..||
  Fly   138 VTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFC 202

  Fly   203 KKNDVTLTGYTPLGKPKPDIQK-----------PDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLG 256
            |..::|:|.|:|||  ...|.|           ||.:..|||..||..:|||..|::||:::..|
  Fly   203 KSENITVTAYSPLG--SKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTG 265

  Fly   257 VIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGL-NHKYYPFSIEF 317
            |..||||:|..|:.:|.|:|||||||||:|.|.......|:.......|: .|..:.|..::
  Fly   266 VSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 127/305 (42%)
Tas 5..297 CDD:223739 127/300 (42%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 126/296 (43%)
Tas 10..297 CDD:223739 125/291 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11732
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.