DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArfGAP1 and Git2

Sequence 1:NP_524040.2 Gene:ArfGAP1 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_017453834.1 Gene:Git2 RGDID:1359708 Length:761 Species:Rattus norvegicus

Alignment Length:535 Identity:115/536 (21%)
Similarity:171/536 (32%) Gaps:142/536 (26%)


  Fly    19 NSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEKMKA------ 77
            |..|.:|...:|.|.||..|..||.||...|||||.|:|.||.:....|....|:.::.      
  Rat     8 NDVCADCSGPDPSWASVNRGTLICDECCSVHRSLGRHISQVRHLKHTPWPPTLLQMVETLYSNGA 72

  Fly    78 ---------------GGNRNAREFLEDQEDWNERAPITQRYNSKA---AALYRDKIATLAQGKSW 124
                           .|.|.|..  :|:...|:...|..:|...|   ....||..:..|:..| 
  Rat    73 NSIWEHSLLDPASVMSGRRKANP--QDKVHPNKAEFIRAKYQMLAFVHRLPCRDDDSVTAKDLS- 134

  Fly   125 DLKEAQGRVGSNN------SFSSGGSSNSSYQSRPSA-----------------TGYGGNGGYQN 166
              |:....|.:.|      ..|.|..:|..:..:.|.                 ..||.:.|..:
  Rat   135 --KQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGSTPLHVASKAGQILQAELLAVYGADPGTHD 197

  Fly   167 GGGAEPGGY-QQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQ- 229
            ..|..|..| :|...:|..::..|.    |.|...|           .|.:...|:|..|.... 
  Rat   198 SSGKTPVDYARQGGHRELAERLVEI----QYELTDR-----------LAFYLCGRKPDHKNGQHF 247

  Fly   230 ---ELFDSTLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKIKEGTLLDSVQCGVTD-VAS 290
               ::.|..|          |.:.|:||..||:|..:..|         .|.:.:...|.| |..
  Rat   248 IIPQMADRRL----------SLDLSELAKAAKKKLQSLSN---------HLFEELAMDVYDEVDR 293

  Fly   291 KVTD---MGKRGWNNLAGSNISSP-------------QGGYNDPNFEDSSAYQRSNSVGGNLAGG 339
            :.||   :..:..:.|.......|             ||......|   :|::.:..|...|:..
  Rat   294 RETDAVWLATQNHSTLVTETTVVPFLPVNPEYSSTRNQGRQKLARF---NAHEFATLVIDILSDA 355

  Fly   340 LGQQSGVSDSDWGGWQDNGN------SKSHMTSSS-----SYHNQLSSSSGGGTASAGLTR---- 389
            ..:|.|   |.....:||..      |..|.|.|.     .|.:..|.........|..|.    
  Rat   356 KRRQQG---SPLSRSKDNVELILRTVSNQHSTESQDNDQPDYDSVASDEDTDVETRASRTNRQKS 417

  Fly   390 -DADWSGFEATNYQSSETSYQNASSGGSTARRNMKLQDTSQKLSEGFESLDVK--------SVKP 445
             |:|.|....|..:..|..:...:   |.|:| .:|...:..||.....:..|        |...
  Rat   418 LDSDLSDGPVTVQEFMEVKHALVA---SEAKR-QQLMKVNNNLSGELRIMQKKLQTLQSENSSLR 478

  Fly   446 KTATASSANKGTAED 460
            :.||||:....||.|
  Rat   479 RQATASACQVQTASD 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 33/119 (28%)
Git2XP_017453834.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.