DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArfGAP1 and agap2

Sequence 1:NP_524040.2 Gene:ArfGAP1 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002933734.2 Gene:agap2 XenbaseID:XB-GENE-1011294 Length:2037 Species:Xenopus tropicalis

Alignment Length:110 Identity:41/111 (37%)
Similarity:54/111 (49%) Gaps:19/111 (17%)


  Fly    10 LQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEK 74
            :|.::....||.|.:||..||.|.|:..|..||:||||.||:||.|||.|||:.:|.| .:||..
 Frog  1791 IQAIRNAKGNSFCVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDW-PLELTL 1854

  Fly    75 MKAG-GNRNAREF----------------LEDQEDWNERAPITQR 102
            :... ||..|...                .|::|.| .||...||
 Frog  1855 VLTSIGNEMANSIWEMTTHGRTKPAPDSSREERESW-IRAKYEQR 1898

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 41/111 (37%)
agap2XP_002933734.2 Centaurin_gamma 1297..1454 CDD:133303
Ras 1301..1454 CDD:278499
PH_AGAP 1559..1771 CDD:241281
PH 1562..>1626 CDD:278594
PH <1702..1766 CDD:278594
ArfGap 1790..1904 CDD:279720 41/111 (37%)
ANK 1915..2016 CDD:238125
Ank_2 1915..2005 CDD:289560
ANK repeat 1915..1945 CDD:293786
ANK repeat 1947..1978 CDD:293786
ANK repeat 1980..2005 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.