DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and SET5

DIOPT Version :8

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_012077.1 Gene:SET5 / 856614 SGDID:S000001250 Length:526 Species:Saccharomyces cerevisiae

Alignment Length:504 Identity:101/505 (20%)
Similarity:177/505 (35%) Gaps:164/505 (32%)


  Fly   150 SILIRLGEGEAALNDL-KLAINFGLELKSSVDYYLKMAKAYAVMGEPARAEISLKIAEKMPGCDA 213
            ::.|::|    .|||. :.|::.|.|..|.   :.|:.        |...||          || 
Yeast     2 TLTIKIG----TLNDSDQSAVHNGTENGSD---FRKIT--------PTEEEI----------CD- 40

  Fly   214 THIALCRKELSSVKPKPKEATSEQV-PQLAHGESAELVGASKVVRL----------VET----KD 263
             .:.|..||    :|..::||.:.: .::.....:..:.||:..::          :||    ||
Yeast    41 -DVVLLWKE----EPGTEDATIQHLYDRITERNQSWKLSASRFRKILNEHHLYDTDLETVSLYKD 100

  Fly   264 K----------------------GRFVVANEGLRTGDVLLFEEPVAACLEP--SYF----GTHCH 300
            |                      ||.:.|......|.::|.|......:.|  ..|    |..|.
Yeast   101 KIHFPKALDSDAKVEVKFIDDEHGRGLFAKRDFSKGQIILKENKPIVYIPPLDKLFLISNGKACA 165

  Fly   301 HCFKRLHT---------PVSCLHCSGIAFCSAQCMGEACS----SYHRFECEYMDLM-IGSGMSI 351
            .|.|.|:.         .:.|..|..| :||.:|.....|    .||.:....:|:: .|:....
Yeast   166 RCGKALYDLTQHKIMVHYLDCEVCKAI-WCSEKCKKAHASLHELLYHSWRSNRIDILHAGNWKRF 229

  Fly   352 LCFIALRIFTQAPSLEQGLATANLLFEHLCSHEEDRQPDDYLRR----------------ALMSG 400
            :.:.....||.|.|:  ||...::|.:.....:|..|....:.:                :|::|
Yeast   230 VNYCEKYCFTAAFSV--GLIYGSMLLDTTGEVKEQWQKLASISQRERIKLRDASGIGSTFSLLNG 292

  Fly   401 FLLRILQKSLYFGRRKTE-----------------GVNPTA---VELQVATALLGLLQVLQYNAH 445
            ..:...::|....::..|                 |..|.|   ::.:....::|...:.|||. 
Yeast   293 TTVHTEEESDNGTKKGVEKNIDDETVWEKCYELFCGAFPKASEEIDFEKFLTMIGTFNINQYNG- 356

  Fly   446 QIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACHFV--GKKLVLTATRPHRANELV 508
            |:|       |..                |:.||:|.|:.....|  .::|.|.|.:|.:..|.:
Yeast   357 QVY-------HWI----------------SFINHDCEPNAYIEQVEEHEELRLHARKPIKKGEQI 398

  Fly   509 AVNY-GPIFIKNNLKERQRSLRGRYSFSCSCMACQ------ENWPLLQK 550
            .:.| .|:   :.::.|:|.||..:.|.|.|..||      |..|.|:|
Yeast   399 RITYVNPL---HGVRLRRRELRVNWGFLCQCDRCQNELSTFERVPNLEK 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150 13/56 (23%)
zf-MYND 299..338 CDD:280009 13/52 (25%)
SET <474..513 CDD:279228 12/42 (29%)
SET5NP_012077.1 SET 41..526 CDD:225491 86/439 (20%)
SET <342..402 CDD:279228 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.