DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and TPR9

DIOPT Version :8

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001321056.1 Gene:TPR9 / 840233 AraportID:AT1G33400 Length:810 Species:Arabidopsis thaliana

Alignment Length:745 Identity:152/746 (20%)
Similarity:271/746 (36%) Gaps:201/746 (27%)


  Fly    39 WLRNYFGKLKSNAARVLSIFSD--REVCDPVLGVLEHVQPVFKQKDALFSAQRRAQADKLYLMSG 101
            :||.|.....|:.:..|.:.|.  .|:.:|.||...      |.::.....:||...     ...
plant    34 YLRYYLQLNFSSLSFSLVLLSQAVSELANPELGCCG------KNEETSLDLKRRGNH-----CFR 87

  Fly   102 SGDGEESRELLQQALMAANLAVMRAPDRNADPVLDEGLTLALAYRSRASILIRLGEGEAALNDLK 166
            |.|.:|:..|..:||..|.|          |.:..:...||..:.:||::|..||..:.:|.|..
plant    88 SRDFDEALRLYSKALRVAPL----------DAIDGDKSLLASLFLNRANVLHNLGLLKESLRDCH 142

  Fly   167 LAINFGLELKSSVD-YYLK----MAKAYAVMGEPARA----EISLKIAEKMPGCDATHIALCRKE 222
            .|:.        :| ||.|    ..|...::|....|    .:|:.:...:.|         :|:
plant   143 RALR--------IDPYYAKAWYRRGKLNTLLGNYKDAFRDITVSMSLESSLVG---------KKQ 190

  Fly   223 L-SSVKPKPKEATSEQVPQLAHGE--SAELVGASKV--------VRLVETKDKGRFVVANEGLRT 276
            | :.:|..|....::   .|.|.|  .:...|...:        :|.|.||:|||.:|:...:..
plant   191 LQNELKAIPDYQNNQ---TLEHDEYRPSNDAGVDHLPSVQMEVKLRCVSTKEKGRGMVSECDIEE 252

  Fly   277 GDVLLFEEPVAACLEPSYFGTHCHHCFKRLHT-PVSCLHCSGIAFCSAQCMGEA--------CSS 332
            ..|:..|||.:..:..|...||||.|...|.. .|.|..||...:||..|..::        ...
plant   253 ASVIHVEEPFSVVISKSCRETHCHFCLNELPADTVPCPSCSIPVYCSESCQIQSGGMLSTNEMDK 317

  Fly   333 YHRFE---CEYMDLMIGSGMSILCFIALRIFTQ-------------APS------------LEQG 369
            :|.|:   .:.::.:.|...:.:.:.|..:..:             .||            :.||
plant   318 HHIFQKLPDDIVEHIKGVTSADIYYFATDLIQEHQHECRGANWPAVLPSDAVLAGRIIMKLINQG 382

  Fly   370 LATANL--LFEHL-CSHEEDR-QPDDYLRRALMSGFLLRILQKSLYFGRRKTEGVNPTAVELQVA 430
            .|..:|  |.|.| .||...: .|::.|...|:|..|:..|.||        ...|.:..|..|.
plant   383 KAATDLSNLQEILELSHTYSKMNPENKLELHLLSIVLIWCLSKS--------SCPNLSVCEASVT 439

  Fly   431 TALLGLLQVLQYNAHQIYQTQ-------------VTEEHRFDGSKTVYLAAGLYGTGSYFNHECW 482
            ..:: ||..::.|:..:.:.:             ::.:......:.:.:...||.|||.|||.|.
plant   440 QTII-LLSQIKVNSIAVARMKSSGDSFKCLPSGNISTKEPIQSLEQIRVGQALYKTGSLFNHSCK 503

  Fly   483 PSTACHFVGKKLVLTATRPHRANELVAVNYGPIFIKNNLKERQRSLRGRYSFSCSCMACQENWPL 547
            |:...:|:.:.|::..|........:.::|||...|.:.|.|.|.|...|.|.|.|..|.:    
plant   504 PNIHLYFLSRGLIMQTTEFVPTGCPLELSYGPEVGKWDCKNRIRFLEEEYFFHCRCRGCAQ---- 564

  Fly   548 LQKLDKQVR-FWCTSANCSNLL-----------------KFPKDLAKDVR--------------- 579
            :...|..:. :.|.:.||:.::                 ..|:::.:.|:               
plant   565 INISDLVINGYGCVNTNCTGVVLDSNVATCESEKLNHFFTAPRNVDQQVQMREKVYADVGEVASS 629

  Fly   580 ---------------CPRCRKNISLKESVAK-------MIKIEELYREAARA-----MEAQKTVE 617
                           |.:|.....::.|.|:       |.::||| ..:.||     .:..:::.
plant   630 LLSKPSGSLHIEPEICLKCGSRCDIENSHAEVNKAWNHMRRVEEL-MNSGRANYSVLSDCSRSIA 693

  Fly   618 AIELFKESLDMFFQVAALPHKDTIVAQQSL 647
            .:..|   |.|:       :||...|:..:
plant   694 VLRTF---LHMY-------NKDIADAEDKV 713

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150 17/72 (24%)
zf-MYND 299..338 CDD:280009 13/51 (25%)
SET <474..513 CDD:279228 11/39 (28%)
TPR9NP_001321056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I1980
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1278034at2759
OrthoInspector 1 1.000 T124991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.