DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-2 and Smyd4-1

Sequence 1:NP_648574.1 Gene:Smyd4-2 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster

Alignment Length:765 Identity:169/766 (22%)
Similarity:283/766 (37%) Gaps:198/766 (26%)


  Fly    42 NY------FGKLKSNAARVLSIFSDREVCDPVLGVLEHVQPVFKQKDALFSAQRRAQADKLYLMS 100
            ||      |..|.|..|.:|.||  :::...:|..||  |||.::..|..|...|.:.:.::..|
  Fly    20 NYKDEFETFKSLASMPADILQIF--QKLALDLLQDLE--QPVDRKGCAERSKNLREEGNLMFKES 80

  Fly   101 GSGDGEESRELLQQALMAANL---AVMRAPDRNADPVLDEGLTLALAYRSRASILIRLGEGEAAL 162
            .||..::|      .|.|..|   ||..|  .||   ::|   |:||:.:|...|...|....|.
  Fly    81 ASGSSKDS------VLKACRLYSEAVFEA--ENA---VEE---LSLAFANRGIALQEYGYYREAY 131

  Fly   163 NDLKLAINFGLELKSSVDYYLKMA------KAYAVMGEPARAEISLKIAEKMPGCDATHIALCRK 221
            :|...|:..|...:......::.|      |..|.:.|.......|::.|..    ...:...::
  Fly   132 DDCSNALECGYPERLRHKVIMRQAFCAWKLKKIASLEEHLDYLGQLQLKESF----EQQLEDLKQ 192

  Fly   222 ELSSVKPKPKE-ATSEQVPQLAHGESAELVGASKVVRLVETKDKGRFVVANEGLRTGDVLLFEEP 285
            :|..:|.:|:| .|..:|...:.||.           |.:...:||::||.|.:..|:|:..|. 
  Fly   193 KLELLKNQPREQETQGKVVDKSLGEI-----------LTDPGPRGRYMVAKEAISKGNVIFSER- 245

  Fly   286 VAACLEPSYFGTHCHHCFKRL-HTPVSCLHC-SGIAFCSAQCMGEACSSYHRFECE--YMDLMIG 346
             |:|..|......|..|...| ..|:.|.:| ..:.:||.:|. ||.|:.|:|||.  ..|::..
  Fly   246 -ASCFVPLEQLLICQQCAATLMSAPIPCPNCHQRVVYCSRKCR-EAHSAIHKFECAAYRKDILRL 308

  Fly   347 SGMSILCFIALR-IFTQAPSLE---QGLATANLLFEHLCS----HEEDRQPDDYLRRALMSGFLL 403
            .|:|   .:||| :.|..|.:.   |.:.:|..::|.:.:    .||.....:|||...|...|.
  Fly   309 LGIS---HLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLD 370

  Fly   404 RILQKSLYFG-----------RRKTEGVN-----PTAVE---LQVATALLGLLQVLQYNAH---- 445
            :.:.:.|.:.           :..|:..:     |.::|   |.::..:|.....|..|.|    
  Fly   371 QAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDA 435

  Fly   446 -----------QIYQTQVTEE---------HRFDGSKTV------YLAAGLYGTGSYFNHECWPS 484
                       .:.|.::.::         |....|..:      ||        |..||.|.||
  Fly   436 LLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAINLPYL--------SLCNHACEPS 492

  Fly   485 TACHFVGKKLVLTATRPHRANELVAVNYGPIFIKNNLK-ERQRSLRGRYSFSCSCMACQENWPLL 548
            ....|.|..:|..|.:.....|.: .|...:..:|:|| :|...|:..|.|.|:|..|....|..
  Fly   493 IRTKFDGCSVVNYAAKDILEGEEI-FNCYTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQ 556

  Fly   549 QKLDKQVRFWCTSANC------------SNLLKFPK-DLAKDVRCPRCRK--------------- 585
            ..|... |:.|...||            :||..:.: :..|.:.|..|.:               
  Fly   557 NYLSFH-RYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAEKPITCTVCHELQHFAWYNEFLGLIG 620

  Fly   586 ---NISLKESV----------------AKMIKIEEL------------------YREAARAMEAQ 613
               :.|.::::                .|.|..|||                  |.:.||.:..|
  Fly   621 SSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQ 685

  Fly   614 KTVEAIELFKESLDMFFQVAALPHKDTIVAQQSLHKCLSDTGTTFKKEGK 663
            ....|.:....|.:   .:|.:.:...|:||:   ||.:|.....:.:||
  Fly   686 LEGIAAQCGDNSTE---YIARMTYLWDIIAQK---KCRTDRKELLEMKGK 729

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150 14/69 (20%)
zf-MYND 299..338 CDD:280009 15/41 (37%)
SET <474..513 CDD:279228 12/39 (31%)
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 15/41 (37%)
SET <447..526 CDD:214614 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56066582
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1278034at2759
OrthoFinder 1 1.000 FOG0002920
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46165
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5130
65.970

Return to query results.
Submit another query.