DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and SmydA-5

DIOPT Version :8

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster

Alignment Length:384 Identity:80/385 (21%)
Similarity:117/385 (30%) Gaps:120/385 (31%)


  Fly   209 PGCDATHIALCRKELSSVKPKPKEATSEQVPQ-------LAHGESAELVGASKVVRLVETKDKGR 266
            |.|.......|.: ...|:...:|...:..||       .:..:.|||               ||
  Fly     8 PVCGVAASQACTR-CKMVRYCDREHQKQHWPQHKRRCRPFSEEQDAEL---------------GR 56

  Fly   267 FVVANEGLRTGDVLLFEEPV--------------------AACLEPSYFGTH-CHHCFKRLHTPV 310
            ::...:.:..|.::..|||:                    ..|..|...|.| |..|    ..||
  Fly    57 YLKVTQNIAAGQIVFIEEPLVVGPKWYLSDADKEASNVPCVGCYTPCRLGKHQCRRC----RWPV 117

  Fly   311 SCLHCSGIAFCSAQCMGEACSSYHRFECEYMDLMIGS--------------GMSILCFIALRIFT 361
                      |||.|..|:      .||..:.|..||              |.::|....|.:..
  Fly   118 ----------CSAGCKHES------MECSVLSLGSGSPTRADARSLNDYFRGDALLVLKCLLLQR 166

  Fly   362 QAPSLEQGLATANLLFEHLCSHEEDRQPDDYLRRA-------LMSGFLLRILQKSLYFGRRKTEG 419
            |:|:....|.       .:.||||:|:..|....|       |...||.|:.|            
  Fly   167 QSPTKWSALL-------EMQSHEEERKGTDLYEEAEKRVVTYLQKRFLCRLKQ------------ 212

  Fly   420 VNPTAVELQVATALLGLLQVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPS 484
            .||..:.......|..|..:::.|...|......|            .:||:.......|.|.|:
  Fly   213 TNPNLLTDCGPEMLHRLCGIIETNFMVIELPSGVE------------LSGLFRQACMMEHACQPN 265

  Fly   485 TACHFVGK--KLVLTATRPHRANELVAVNYGPIFIKNNLKERQRSLRGRYSFSCSCMAC 541
            ....|..|  ::.:.|....|..:.:.:.|..|.....|  ||..||....|||.|..|
  Fly   266 CDFQFDNKTQQVAVRAGCDLRKGDHLRITYTNILWGTQL--RQHHLRLTKHFSCRCSRC 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150
zf-MYND 299..338 CDD:280009 10/39 (26%)
SET <474..513 CDD:279228 8/41 (20%)
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009 7/36 (19%)
SET 185..295 CDD:279228 24/134 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56066723
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.