DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and btn

DIOPT Version :10

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:68 Identity:26/68 - (38%)
Similarity:38/68 - (55%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQN 489
            ::.||..:..|.||.:|.|..|....|..|..:|....|:.|.|:|||||:|.|.|:|:.: :|.
  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLE-EQQ 150

  Fly   490 GGS 492
            |.|
  Fly   151 GSS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:413332
Homeodomain 425..481 CDD:459649 21/55 (38%)
btnNP_732768.1 Homeodomain 87..143 CDD:459649 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.