DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: atf3 and kay

Sequence 1:NP_957258.1 Gene:atf3 ZFINID:ZDB-GENE-040426-728 Length:202 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:136 Identity:49/137 (36%)
Similarity:69/137 (50%) Gaps:18/137 (13%)


Zfish    26 GSLTLDDFTNFTPLVKEELRYAIQNKR--MSNGMSTLTTDRACMNTERPTELPGMKR-----EAV 83
            ||:......||:.::.     |:.:.|  .|.|.|...|.    ||  |....|.:|     ...
  Fly   361 GSVNGGGVNNFSNVLA-----AVSSSRGSASVGSSNANTS----NT--PARRGGGRRPNRSTNMT 414

Zfish    84 PEENDRRKRRRERNKIAAAKCRNKKKEKTDNLQKESEKLESINAELKAQIEELKNQKQQLVYMLN 148
            |||..:|..||||||.|||:||.::.::|:.|.:|.|:||.....::.:||.|.|.|.||.|:|.
  Fly   415 PEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLA 479

Zfish   149 LHRPTC 154
            .||.||
  Fly   480 THRATC 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
atf3NP_957258.1 bZIP_ATF3 99..150 CDD:269870 20/51 (39%)
coiled coil 99..147 CDD:269870 19/48 (40%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 27/61 (44%)
coiled coil 421..480 CDD:269869 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.