DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rbm17 and Spf45

Sequence 1:XP_005164871.1 Gene:rbm17 ZFINID:ZDB-GENE-040426-817 Length:419 Species:Danio rerio
Sequence 2:NP_001036426.1 Gene:Spf45 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster

Alignment Length:455 Identity:170/456 (37%)
Similarity:226/456 (50%) Gaps:93/456 (20%)


Zfish     1 MSLYDDLGVATSDAKTEGWSKNFKLLQSQLKVKKAALTQAKTQRTRQSNVLAPVIDLKRGSGGDD 65
            |.|||.:......::.:|||...|:||:||.||.|.          :..::.||::|:.....|.
  Fly     1 MDLYDGIDTRARSSQIDGWSSGIKMLQTQLAVKMAV----------KKPLMTPVVNLRSKRLADP 55

Zfish    66 RQISDTP-------PHIAAGMKDSSSGGFSSGDVLIPLADEYDPMFPNDYEKVLKRHREERQKQR 123
            ......|       |.|:.....|.....:.||  ..:||||||..||:|||:     :|:....
  Fly    56 EVTCFAPITTVVSKPLISGKALPSILERINRGD--WDVADEYDPQRPNEYEKL-----KEKSNGS 113

Zfish   124 EQERQ--KEIEEREKKRKERHEGGGGG--------GAP----SGFSRFPTEGESDEEEDYEREKR 174
            ::.|.  .:.|:|:.|.|:|..|..|.        .||    |||      |....::|......
  Fly   114 DKNRAGVSDREDRDDKEKDRKRGRVGRREFYRDEVSAPNLKLSGF------GHRQNDDDMYLPSP 172

Zfish   175 KRTA--GGAAIAPPTSLVERDSSFTYDEDGRQRTKAAIPPPVFEDSDRPRSPPGPANSFLANMGG 237
            ...|  |||.||||.||.|...     :.|.:.|               .:.|..|:|       
  Fly   173 GLVAKQGGATIAPPPSLQEMSI-----DSGCEAT---------------NTMPYSASS------- 210

Zfish   238 TVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKII----------------IGDSTEK 286
             ||.|||.||||::||||||.|||::.||.|||||||||:||                ||  ::.
  Fly   211 -VAAKIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGRIIHEKDVFLPPLALSPPSIG--SQI 272

Zfish   287 TTGPSQNVANPDGSNSADASKKNETNPLTEILKCPTKVVLLRNMVGRGEVDEDLEAETKEECE-K 350
            .|.||.....|.......|...:....:|||:|.|:||||||||||.|:|||:||.|.|:||. |
  Fly   273 GTSPSHKAMPPPQMVDTAAESGDIGYSITEIMKSPSKVVLLRNMVGPGDVDEELEPEVKDECNTK 337

Zfish   351 YGKVVRCVIFEISGVTDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDRFRVLDL 415
            ||:|...:|.|..|...::||:||:||.|:|||||||||||||:||||.|:|.|||.|:|:...|
  Fly   338 YGEVNSVIIHESFGTVPEDAVKIFVEFRRIESAIKAVVDLNGRFFGGRQVRAGFYNYDKFKCFQL 402

Zfish   416  415
              Fly   403  402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rbm17XP_005164871.1 G-patch 239..276 CDD:279867 28/37 (76%)
RRM_UHM_SPF45 321..415 CDD:241091 59/95 (62%)
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 29/47 (62%)
RRM_UHM_SPF45 307..402 CDD:241091 59/95 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231629160
eggNOG 1 0.900 E1_KOG1996
Hieranoid 1 1.000
Homologene 1 1.000 H13162
Inparanoid 1 1.050 226 1.000 Inparanoid score I3405
OMA 1 1.010
OrthoDB 1 1.010 D1101846at2759
OrthoFinder 1 1.000 FOG0005792
OrthoInspector 1 1.000 T1052520
orthoMCL 1 0.900 OOG5_129437
Panther 1 1.100 LDO PTHR13288
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3833
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.