DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atg12 and atg12

Sequence 1:NP_648551.3 Gene:Atg12 FlyBaseID:FBgn0036255 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_593661.1 Gene:atg12 PomBaseID:SPAC1783.06c Length:132 Species:Schizosaccharomyces pombe

Alignment Length:110 Identity:33/111 (30%)
Similarity:64/111 (58%) Gaps:1/111 (1%)


  Fly     3 ETPESQ-AALSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNKTVGWIQTFIHKFLKLD 66
            |..|:| .::.|..:|..:|:..::.:...|.|..|:::|..::::.::....:..|:.|.|.|.
pombe    23 EDIENQLPSIETIINTYREKENRRVNLRFKAIGRTPLLRKTVFSINASQRFEKVTRFLKKELGLP 87

  Fly    67 ASEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG 111
            .:..:.||||.:|||:||:|:.|||:....:..|::.||.|.|:|
pombe    88 MNSSLVLYVNSSFAPSPDEIVGNLYDNFAIDSHLLINYCINVAFG 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atg12NP_648551.3 APG12 25..111 CDD:252381 26/86 (30%)
atg12NP_593661.1 APG12 46..132 CDD:252381 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1919
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004002
OrthoInspector 1 1.000 T1125657
orthoMCL 1 0.900 OOG5_130185
Panther 1 1.100 LDO PTHR13385
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R104
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.