DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43896 and Mur89F

Sequence 1:NP_001261732.1 Gene:CG43896 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster
Sequence 2:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster

Alignment Length:1590 Identity:301/1591 (19%)
Similarity:486/1591 (31%) Gaps:483/1591 (30%)


  Fly    42 NCSSYYRCTAK-----NAVRTVTCAPGKEYNPKNGKC---TMAGRSLCKLSLLAPLAEATNVCST 98
            :|:.:|||...     |.| ...|:||..::|....|   |...:..||     .:|..:...|:
  Fly   757 DCARFYRCVENGSGGFNKV-PFDCSPGTVWDPDTKGCNHPTDVQKEQCK-----AMANGSGSSSS 815

  Fly    99 EVNGAYIANSGSCGEFYICDEQIAYPQKCDLGSFFNETLAACIPDANSTCWQNLCINKTNGVFVE 163
            :.:.:...:|.|.|...............:.||..|:..::   :..|:..|....|:.:.....
  Fly   816 QGSSSNQGSSSSQGSSSNQGSSSNQGSSSNQGSSSNQGSSS---NQGSSSNQGSSSNQGSSSNQG 877

  Fly   164 NEANCGSYYVCSNGEATLQ--------TCPQGSFFN---TSVAACTVDQGNSQCWVNYCIGQDDG 217
            :.:|.||  ..|.|.::.|        :..|||..|   :|....:..||:|.   |.....:.|
  Fly   878 SSSNQGS--SSSQGSSSNQGSSSNQGSSSNQGSSSNQGSSSNQGSSSSQGSSS---NEGSSSNQG 937

  Fly   218 SAVADKSNCSLFYVCSNNTATAQECPEGSYFESNNWGCV--------PGTCTTESPCDD------ 268
            |:.:..|:       ||..:::.:....:...|:|.|..        .|:.:.:|...:      
  Fly   938 SSSSQGSS-------SNQGSSSNQGSSSNQGSSSNQGSSSNQGSSSNQGSSSNQSSSSNQSSSNQ 995

  Fly   269 -------STTTTTESCAEETTEPPASCDCGDIKNADFIPDEENCRKYFICIDGVLVAADCGKGNV 326
                   |:..|:.|..::..:|...|:    ....|:.|.|||.|::.|:|.       |||..
  Fly   996 SSSNQSSSSNQTSSSTTQKPFKPAEKCE----SEETFLADNENCSKFYRCVDN-------GKGGF 1049

  Fly   327 FNANLSVCEVDADNTCCVADCTDGEAKVDPQDC-------TKYFKCQSGDWTSVSCDSGSYFNET 384
            ...:.         ||......|.||    ..|       ||..||:     .|....||..|.|
  Fly  1050 TKVSF---------TCPPNTLWDPEA----NSCNHPDQIQTKPLKCK-----KVVSQGGSSSNST 1096

  Fly   385 LNCCQVDVNNVCIDAKSNSTQIPTTSTVETSSVDKCNAKDPPASGKNCWTYQHCISGQWEDGTCP 449
            .|......|:.......:|:...::::..:|:....:.....:||.:........||........
  Fly  1097 SNSSSSSNNSGSSSNSGSSSSSSSSNSGSSSNTGSSSNSGASSSGGSSNQGSSSNSGSSSGSNSS 1161

  Fly   450 NNTYFDASVGICREDTENVCPENRSSGSRQKRSVEDC-----TCEGGIAQGTIIGHSTDCDKYLI 509
            .|....:|.......:.|....:.||.|....|....     ||:   ..|..||..:||.|:..
  Fly  1162 GNQSTSSSTSSSSSSSNNNNQGSSSSSSSSSSSTSSKPNPSETCK---VNGQFIGDRSDCAKFYR 1223

  Fly   510 CENG-----QLVEGVCGVGNVFQ------------KSSGICVPDTKATCWVCSNKPNGYQMADPT 557
            |.:.     .:|...||.|.|:.            |..|...|.|.:|  ..:::|.....:.|:
  Fly  1224 CVDNDRGGFNMVPFSCGPGTVWDAQMQACNHAWAVKECGGIAPPTTST--PTTSRPTTASTSRPS 1286

  Fly   558 DCTSY------------LTCWNGLATKHTCGSGEWY-------NGDGNC-----VIDVN-----A 593
            |.||.            :|.....::..|..|.:..       |.||.|     :.|.|     .
  Fly  1287 DQTSTSRPTGPPTTARPVTARPTTSSPTTASSSQTTSPVTQAPNTDGKCRSEGFMADPNNCSKFY 1351

  Fly   594 KCIN---------PCSCGNGNVAH---PICT-NYFQCTDGVPQV---KQCVVGEAFDSATGQCST 642
            :|:.         |..||.|.|..   ..|. |:..|:.|....   ..|.......:||...||
  Fly  1352 RCVRNNKGGFTSIPFQCGAGTVWDQDLQTCNHNFNNCSTGTESTTPKPPCEPATNGTTATSTSST 1416

  Fly   643 TVECSA-----------------------------------------------------KNCATA 654
            |.....                                                     ....|.
  Fly  1417 TTPPPTTTDLPPTSTTGLPPTTTTELPPTTTTDLPPTTTTRLPPTTTTSLPPTTTTGLPPTTTTG 1481

  Fly   655 SDGTTYPVAGETGQFYVCLSNEATIQPCPVNTGYSAALGICLDQPSPDCDQTICNSAAVDST--- 716
            :..||..::.||....|..|.|:|.||....|          .:|.|         |..:.|   
  Fly  1482 AQPTTTTLSSETETSTVTTSPESTTQPPSTTT----------MKPLP---------AGTECTGEG 1527

  Fly   717 YPSNDNDSSTFCLCRDSGA----YIQSCPTGLFYDATDQVCTFSGNCDPQVCNDQSEYFV---SP 774
            |.::..|...:..|.::||    |..:||.|..::...|.|.:..|. |:.....:|...   |.
  Fly  1528 YMADPEDCRKYYRCINAGASYRKYNFTCPKGTGWNEEVQTCDYVENI-PRCSKLPAEPITTTPSE 1591

  Fly   775 DYEDPNSFCLCRAGEPITVSCPIGYTFNTEELECVLIPLPDPRCCANGCSGK----------TDF 829
            :.:||.|.......||.||:.||  |..|||........|..:......:.:          |::
  Fly  1592 ESKDPGSTTPQSTDEPTTVTKPI--TKPTEEPSTEKPQKPTTQYPEKPTTTEEPEKPQKPTTTEY 1654

  Fly   830 STFPTIEGTDGFCLCVDDVPKYISCPENSQYDLELGACTATEEET-TCPVNACTVGICESALDFN 893
            ...||.  |:      :..|:....|..::|..:   .|.|||.| ..|....|.       ::.
  Fly  1655 PQKPTT--TE------EPTPEKPQKPTTTEYPQK---PTTTEEPTPEKPQKPTTT-------EYP 1701

  Fly   894 TFPVSSDPSGFCYCLDSCPIYETCLDDLVYNEDLKRCTEPEDPSVVSRCDAEKCDSIPDF----T 954
            ..|.:.:|:     ..|.|.|                    :|:..         |:|.:    |
  Fly  1702 QKPTTEEPT-----TTSIPGY--------------------NPTTT---------SVPGYNPTTT 1732

  Fly   955 PYP--SINGTDGFCYCNGGLPVFRECEENQEFDPAVGFCRTVVDSCVTALCDANQCATLDNYVPF 1017
            |.|  :...|.|:.....|.|:                ..|.:.|..|   ||.|..|... .|.
  Fly  1733 PIPVETTTSTPGYKPTTTGEPI----------------TTTTLPSTTT---DAIQEPTTSK-KPE 1777

  Fly  1018 PTNTASDDDGAFCYCKDGEVILEQ--------CSPE------------------------MVFSA 1050
            ||.|....:.:   ..:|.|...|        ||.|                        .|::.
  Fly  1778 PTTTTESPESS---TPEGSVTTLQPEPQPNYNCSSEGFFPDPEDCSRYYRCVDAAKNGKYQVYAF 1839

  Fly  1051 DLGRCTVQAAPECVC-----APGKCGSSDGYTTYEALNTNEGFC--------------------- 1089
            ..|:.||.......|     ..|.|  |.|.||.....|..|..                     
  Fly  1840 KCGKGTVWDTSTETCNYADQVSGNC--SSGQTTTPGTTTEPGTTESTTSSGKPETTSKAPENTTT 1902

  Fly  1090 ----LCVSGTPVFTECLNGETYNSILGACFSST-------AKIIASGLCDDRRCHSRAVVDATFA 1143
                ...:.:|..|..:..||..:..|...::|       .|...:.:..:....|::.......
  Fly  1903 WAPETTTTSSPETTTTVASETTTTTSGTTTTATPETTTKPPKPETTTIAGEETSTSKSPTTTESP 1967

  Fly  1144 AVNT-TSGYCSCQDVGVSTFINCADEHVYEESAGTCVVAACDYTSCLNRVAFEPFEAKNTT---E 1204
            |.:| ||..|.....|.:.::.......:.|..|  :...|..::..|.:....|:..|.|   :
  Fly  1968 APSTNTSAPCPETGPGQNVYVCPTGFRRHPEKCG--MFYQCSESADNNDLNIVVFQCPNGTVYQD 2030

  Fly  1205 GFCSCDGVPYFHQC-----QTGHVFDKAQGICLLKDTMAMISCNLRECLKRSQFEP-------FA 1257
            ..|||...|...:|     :|.:.|::              ...|:..::.|..:|       ||
  Fly  2031 KSCSCGKPPAGDKCSKDMKRTTNAFEE--------------ETKLQNVVQISTTDPLCPDEGHFA 2081

  Fly  1258 AENTNSG--FCSCDDLQ---RVSVTYHPCGEGEIFAPEFGMCTSHSIQKRSVEAEENICISNEMR 1317
            ..|...|  |..|...:   |:....|.|.:|..:         .::.:|...|          |
  Fly  2082 LNNDQCGQLFVKCGFSELTGRIEGQIHRCPQGFAY---------WNVSRRCEPA----------R 2127

  Fly  1318 SVPANCSQYEMCIDG----RW-----RRRT 1338
            .:| ||:.....:.|    .|     |||:
  Fly  2128 KLP-NCTPTTYNVGGNVPLEWLNIGHRRRS 2156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884 8/51 (16%)
CBM_14 153..206 CDD:279884 15/64 (23%)
CBM_14 211..257 CDD:279884 8/54 (15%)
CBM_14 298..343 CDD:279884 13/45 (29%)
CBM_14 354..395 CDD:279884 12/48 (25%)
CBM_14 427..468 CDD:279884 7/41 (17%)
ChtBD2 488..535 CDD:214696 15/64 (23%)
CBM_14 544..593 CDD:279884 14/78 (18%)
CBM_14 <1320..1361 CDD:279884 8/29 (28%)
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884
ChtBD2 1752..1797 CDD:214696
CBM_14 1820..1868 CDD:279884
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884 12/42 (29%)
CBM_14 1025..1074 CDD:279884 17/69 (25%)
CBM_14 1206..1261 CDD:279884 13/58 (22%)
CBM_14 1336..1388 CDD:279884 10/52 (19%)
CBM_14 1523..1577 CDD:279884 14/55 (25%)
VAD1-2 <1599..>1656 CDD:291956 12/59 (20%)
CBM_14 1809..1861 CDD:279884 6/52 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.