DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: byn and tbx5

Sequence 1:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_001185697.1 Gene:tbx5 XenbaseID:XB-GENE-486855 Length:520 Species:Xenopus tropicalis

Alignment Length:527 Identity:150/528 (28%)
Similarity:228/528 (43%) Gaps:125/528 (24%)


  Fly    99 RFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRWKYVNGEWVPGGKAEVP 163
            :|.....|:::.:.||||||..|:..:||:|...|.:|::.|..|.||:|:.:.:|...||||..
 Frog    66 KFYKRMTELLIKRAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPA 130

  Fly   164 PSNPIYVHPESPNFGAHWMKEPISFAKVKLTNK-TNGNGQIMLNSLHKYEPRVHLVRV------G 221
            ....:||||:||..|||||::.:||.|:||||. .:..|.|:|||:|||:||:|:|:.      |
 Frog   131 MPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFG 195

  Fly   222 SEQRHVVTYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAF-------------LDAKERPDTLY 273
            |:.....|:.|.||.|||||:|||.::|.|||:.|||||.|             :.:||.|    
 Frog   196 SKNTAFCTHVFSETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRMQSKEYP---- 256

  Fly   274 PHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAES---VGPSSGGS---CD 332
                    ::|..|                :.|.   |:|..|..|.|:   .|.|:..|   |:
 Frog   257 --------VVPRST----------------VRQK---VSSNHSPFSQETRNITGSSTLNSQYQCE 294

  Fly   333 RYGRSLSSRSVAPTRTTPYSRPRVVSG--------SGSNGSAGNASSTSPQPPSAPQTPTSLHST 389
            . |.|.:|:.:.||.....|.|. .||        .|.:......|...|...::|......:.:
 Frog   295 N-GVSSTSQDLLPTSNAYPSLPH-ESGPIYHCTKRKGKHVRLTEHSYKKPYMDTSPSEEDPYYRS 357

  Fly   390 STGSVSTSVSSSSGGGIGSAPSTGCFSSSYAQSGFMSVDASPTASVFSYP-SSWQSNGNYWNATS 453
            .....|:|.||::.....||....|..:|.|.:      ..|..|:.... :||.|..:|.:.|.
 Frog   358 GYPQPSSSSSSTTSFRTESAQRQACMYASSAPA------TEPVPSLEDISCNSWSSVPSYSSCTV 416

  Fly   454 VPGPMPMNVCSGRNISSHNSPSPTNGSPSYTTSS--PSYTIHHLTPHSHQYNMAQTDIYGTGVGV 516
            ..|..||.....::.|:|           :|:||  |..:.|..|..|..::|.|          
 Frog   417 GGGMQPMERLPYQHFSAH-----------FTSSSLMPRLSNHAGTQPSDSHSMFQ---------- 460

  Fly   517 GGGAGTTGSPQAAYGAAAHQ------VYHPTPTSPTHQLYTNAVLNAPSALS----YSASG---- 567
                     .|:::.|...|      :...:...||..||.::|   |..:|    :|..|    
 Frog   461 ---------HQSSHQAIVRQCNPQSGLQQSSALQPTEFLYPHSV---PRTISPHQYHSVHGVSMV 513

  Fly   568 --WHNGS 572
              |:..|
 Frog   514 PDWNENS 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 TBOX 86..268 CDD:238106 80/189 (42%)
tbx5NP_001185697.1 TBOX 66..241 CDD:238106 78/175 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.