DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: byn and bi

Sequence 1:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_001259238.1 Gene:bi FlyBaseID:FBgn0000179 Length:1023 Species:Drosophila melanogaster

Alignment Length:746 Identity:195/747 (26%)
Similarity:282/747 (38%) Gaps:170/747 (23%)


  Fly    16 LSGNVSGGGGGGGAGGGAGSGSPQHVTHNG-HGHGHGLGGVAAVSGGGASVSGNGGHRVVGGAGS 79
            |:|:.:|...|...|||.  ..|.|  |.| |.|.|.||.....:           ..||..:..
  Fly   254 LAGSPAGPHPGLYPGGGL--RFPPH--HPGAHPHAHHLGSAYTTA-----------EDVVLASAV 303

  Fly    80 PNELDRNLR-----------------ISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGL 127
            .::|...:|                 ::|:.::||.:|..|..||::||:||:|||.:|...|||
  Fly   304 AHQLHPAMRPLRALQPEDDGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGL 368

  Fly   128 DPAAMYTVLLEFVQIDSHRWKYVNGEWVPGGKAEVPPSNPIYVHPESPNFGAHWMKEPISFAKVK 192
            |..|.|.:||:.|..|.:|:|:.|..|:..|||:......:|:||:||..|..||::.:||.|:|
  Fly   369 DAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLK 433

  Fly   193 LTNK-TNGNGQI---MLNSLHKYEPRVHLVRVG-------SEQRHVVTYPFPETQFIAVTAYQNE 246
            |||. ::.:|.:   :|||:|||:||.||||..       |..|   ||.|.||:||||||||||
  Fly   434 LTNNISDKHGFVSTTILNSMHKYQPRFHLVRANDILKLPYSTFR---TYVFKETEFIAVTAYQNE 495

  Fly   247 EVTSLKIKYNPFAKAFLDA----KER-----------PDTLYP----------HDTHYGWLIPPP 286
            ::|.|||..|||||.|.|.    :|:           .|.|.|          |..|.|  .||.
  Fly   496 KITQLKIDNNPFAKGFRDTGAGKREKKQALMSNRGSDSDKLNPTHVSSSRAPLHLGHAG--RPPH 558

  Fly   287 THYTAA-----------AAAVAAPP-----PL--SIAQSHGLVASCPSVSSAESVGPSSGGSCDR 333
            .|..||           ...|..||     ||  |:.|.|....|....:....:..:..|:.:.
  Fly   559 LHPHAALLDNQQDDDDKLLDVVGPPQSPLLPLSHSLQQMHAHQHSAALAAWFNHLAGAGAGASEH 623

  Fly   334 YGRSLSSRSVAPTRTTPYSRPRVVSGSGSNGSAGNASSTSPQPPSAPQTPTSLHSTSTGSVSTSV 398
            ...:.::.|..............|...||:.|...:...|        |..:...|||||...:|
  Fly   624 AAAAAANASAEDALRRRLQADADVERDGSDSSCSESVGGS--------TGGAFRPTSTGSPKEAV 680

  Fly   399 -SSSSGGGIGSAPSTGCFSSSYAQSGFMSVDASPTASVFSYPSSWQSNGNY--------WNATSV 454
             ::::....|..|..|.:.|.....| ..:..||....:.||     :|.|        .|..:.
  Fly   681 GAAAAAAAAGLNPGGGSYPSPNISVG-PPIHPSPHLLPYLYP-----HGLYPPPHLGLLHNPAAA 739

  Fly   455 PGPMPMNVCSGRNISS--------------------HNSPSPTNG------SPSYTTSSPSYTIH 493
            ....|..:..|...::                    |...||..|      ||.....|......
  Fly   740 AAMSPAGLNPGLLFNAQLALAAQHPALFGHAYAAAGHTPVSPLQGLKSHRFSPYSLPGSLGSAFD 804

  Fly   494 HLTPHSHQYNMAQTDIYGTGVGVGGGAGTTGSPQAAYGAAAHQVYHPTPTSPTHQLYTNAVLNAP 558
            .:||.|:. |.:.....|.|.|:|||....|....:.........|..||.|.....|    ..|
  Fly   805 AVTPGSNA-NRSGDPPGGGGGGLGGGVVENGPRSLSSSPRPRPASHSPPTRPISMSPT----TPP 864

  Fly   559 SALSYSASGWHNGSGAEYGLYQNAAAAYYQPEYIPLEIGYATHPLEPVDVSKTLDDPQAAMYKPS 623
            |.:.....|             .|.|...|.::.|.|:......:..::|........||     
  Fly   865 SLMKQPRGG-------------GAGAGVAQSQHSPSELKSMEKMVNGLEVQHNGSAAAAA----- 911

  Fly   624 DEQGSVITLECASSSLKSSHDIKIESSSLEH 654
                  ..|:.|..:.:..|..:......:|
  Fly   912 ------AALQLAEEAAQHHHHTQAHHQQQQH 936

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 TBOX 86..268 CDD:238106 90/214 (42%)
biNP_001259238.1 Optomotor-blind <260..318 CDD:287988 18/73 (25%)
T-box 330..513 CDD:279278 87/186 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11267
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.