DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: byn and tbx-36

Sequence 1:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_502266.1 Gene:tbx-36 WormBaseID:WBGene00006555 Length:331 Species:Caenorhabditis elegans

Alignment Length:199 Identity:49/200 (25%)
Similarity:88/200 (44%) Gaps:27/200 (14%)


  Fly    78 GSPNELDRNLRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQI 142
            |.|   |.::.||...::.|.:...: :|::|.|:.|::||..|.|..|||||.:|:|.:.|..:
 Worm    19 GQP---DISIEISEITKKQWNQLIGI-HEVVVYKDCRKLFPAAKFSVRGLDPALLYSVEICFDVL 79

  Fly   143 DSHRWKYVNGEWVPGGKAE--VPPSNPIYVHPESPN-----FGAHWMKEPISFAKVKLTN----- 195
            ....:.|       ..|.|  :|...|:.....:.:     .|..:|...:.|..:.:|:     
 Worm    80 SPFTFSY-------NKKLEKWIPTKTPVNCQSSALSSMICETGDWFMNGDMDFGALNITSSHEKA 137

  Fly   196 --KTNGNG-QIMLNSLHKYEPRVHLVRVGSEQR-HVVTYPFPETQFIAVTAYQNEEVTSLKIKYN 256
              |...|. .:.|:|...|:.||.|..:.:::. ::....|.|..||..|.|:.:....||...|
 Worm   138 KEKIEQNRIAVCLSSRTMYQIRVVLYEMQNDELIYLKETKFDEMIFITCTEYRGQVNRELKKSMN 202

  Fly   257 PFAK 260
            .|::
 Worm   203 RFSR 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 TBOX 86..268 CDD:238106 46/192 (24%)
tbx-36NP_502266.1 TBOX 25..215 CDD:214656 46/191 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.