DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: byn and tbx-40

Sequence 1:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_502852.1 Gene:tbx-40 WormBaseID:WBGene00006559 Length:380 Species:Caenorhabditis elegans

Alignment Length:514 Identity:105/515 (20%)
Similarity:174/515 (34%) Gaps:164/515 (32%)


  Fly    86 NLRISLDDRELWL-RFQNLTNEMIVTKNG-RRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRWK 148
            |::::.:||  || ::.|:  ||||...| :.:||.:..:.:||:..:.|.|||...:.|:.|:.
 Worm     8 NVQMAEEDR--WLTQYPNM--EMIVNNKGPKPIFPELNFNITGLEEKSRYVVLLSIQKFDNIRYG 68

  Fly   149 YVNGEWVPGGKAEVPPSN---PIYVHPESPNFGAHWMKEPISFAKVKLTNK---TNGNGQIMLNS 207
            :.||:|.|..........   ..::||:....|...|||.|.|..|::||.   .:.:....:.:
 Worm    69 FKNGKWGPSKVRHATKKEQEIKYFLHPDGTKLGEELMKETIKFDTVRITNHKKFMDKDNVFFVET 133

  Fly   208 LHKYEPRVHLVRVGSEQRHVVTYPFPETQFIAVTAYQNEEVTSLKIKYN---PFAKAFLDAKERP 269
            :|||.|.:.:..:.:.:....:......||..||.|..|.:.:.|.|::   .|........:|.
 Worm   134 MHKYVPVLTVKNITNVESANHSMRMEVAQFFPVTVYNQESIGNWKSKFHKNATFENRLDGGNKRK 198

  Fly   270 DTLYPHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAESVGPSSGGSCDRY 334
            :|                                              :|.|.  ||        
 Worm   199 NT----------------------------------------------NSREE--PS-------- 207

  Fly   335 GRSLSSRSVAPTRTTPYSRPRVVSGSGSNGSAGNASSTSPQPPSAPQTPTSLHSTSTGSVSTSVS 399
                |.||...|........:|.|                      |:.....||::|.:...:|
 Worm   208 ----SKRSKNETEIAVLDILQVAS----------------------QSENYNESTNSGRLQNEIS 246

  Fly   400 SSSGGGIGSAPSTGCFSSSYAQSGFMSVDASPT-ASVFSYPSSWQSNGNYWNATSVPGPMPMNVC 463
            ||    |...|||. :.:.|..: :.:|:..|. |..|..|...:.|..|........|      
 Worm   247 SS----IHQFPSTS-YQNQYPHA-YPTVNTPPIYAQQFPAPFDEKQNQFYPKTDENLAP------ 299

  Fly   464 SGRNISSHNSPSPT---NGSPSYTTSSPSYTIHHLTPHSHQYNMAQTDIYGTGVGVGGGAGTTGS 525
               |.:...|..|.   |...|:....|    :|  |:.|||:                      
 Worm   300 ---NCAQDASSLPNFAMNQKASFANQYP----YH--PYYHQYS---------------------- 333

  Fly   526 PQAAYGAAAHQVYHPTPTSPTHQLYTNAVLNAPSAL--SYSASGWH---NGSGAEYGLY 579
                      |:.|.:|..     |.|..:|:.|:.  |:|....:   ||:...|..|
 Worm   334 ----------QLDHGSPYQ-----YMNNSINSDSSFQSSFSTENSYFDDNGNPIHYPYY 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 TBOX 86..268 CDD:238106 49/193 (25%)
tbx-40NP_502852.1 T-box 24..186 CDD:279278 42/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.647 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.