DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: byn and tbx4

Sequence 1:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:XP_002933872.1 Gene:tbx4 XenbaseID:XB-GENE-951382 Length:541 Species:Xenopus tropicalis

Alignment Length:580 Identity:160/581 (28%)
Similarity:238/581 (41%) Gaps:162/581 (28%)


  Fly    12 PTTGLSGNVSGGGGG---GGAGGGAGSGSPQHVTHNGHGHGHGLGGVAAVSGGGASVSGNGGHRV 73
            |||..:|:.....|.   |.||......|||                                  
 Frog    15 PTTQTAGHAEAAAGSPTLGVAGLSTSLSSPQ---------------------------------- 45

  Fly    74 VGGAGSPNELDRNLRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLE 138
               :..|.:...|:::.|.::|||.:|.....|||:||.||||||..|:..:|::|...|.:|::
 Frog    46 ---SQDPEQTIENIKVYLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLID 107

  Fly   139 FVQIDSHRWKYVNGEWVPGGKAEVPPSNPIYVHPESPNFGAHWMKEPISFAKVKLTNK-TNGNGQ 202
            .|..|.||:|:.:.:|:..||||......:||||:||..|||||::.:||.|:||||. .:..|.
 Frog   108 IVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGH 172

  Fly   203 IMLNSLHKYEPRVHLVRV------GSEQRHVVTYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKA 261
            |:|||:|||:||:|:|:.      ||:.....|:.|.||.||:||:|||.::|.|||:.|||||.
 Frog   173 IILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFSETSFISVTSYQNHKITQLKIENNPFAKG 237

  Fly   262 F------------LDAKERP----------------------DTLYP-HDTHYGWLIPPPTHY-- 289
            |            |.:||.|                      ..|.| |.:|.|.     .||  
 Frog   238 FRGSDDSDLRVARLQSKEYPVISKSIMRQRLVSSHPGQLSGKSDLNPLHGSHQGL-----QHYQY 297

  Fly   290 -----TAAAAAVAAPPPL---SIAQSHGLVASC------------PSVSSAESVGPSSGGSCDRY 334
                 ...|.:.|...||   :..:..||...|            |...|  .:.|||..:.|.|
 Frog   298 ENGAHMQFAPSDAQDLPLNTFTAQRDSGLFYHCLKRREGARHLDLPCKRS--YLDPSSSMADDHY 360

  Fly   335 GRS---LSSRSVAPT---RTTPYSRPRVVSGSGSN--GSAGNASSTSPQPP-------------- 377
            .||   ...:.::|:   ..|| ..|.:.|.||:.  |.:|......|.||              
 Frog   361 FRSPPPYDQQMLSPSYRNEVTP-REPCMYSTSGAEIAGVSGVEDLPPPPPPLSCNMWTSVSPYTS 424

  Fly   378 -------SAPQTPTSLHSTSTGSVSTSVSSSSGGGIGSAPSTGCFSSSYAQSGFMSVDASPTASV 435
                   :.|..|...|.|:|..:....:.:   |.||.|.        .:|.|         ||
 Frog   425 YSVQTMETVPYQPFPTHFTTTTMMPRLPAIA---GQGSQPP--------GESHF---------SV 469

  Fly   436 FSYPSSWQSNGNYWNATSVPGPMPMNVCSGRNISSH-NSPSPTNGSPSYTTSSPSYTIHH 494
            ::..|..|:.....:::.....:..::|..:..|.| |:.:....|.|::.|..|...:|
 Frog   470 YNQLSQSQARERVPSSSFPRERVHPSLCERKPPSPHINTANEFLYSQSFSLSRESSLQYH 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 TBOX 86..268 CDD:238106 88/201 (44%)
tbx4XP_002933872.1 TBOX 55..244 CDD:238106 85/189 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.