DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: byn and mga

Sequence 1:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:XP_012824488.1 Gene:mga XenbaseID:XB-GENE-492360 Length:3054 Species:Xenopus tropicalis

Alignment Length:447 Identity:119/448 (27%)
Similarity:186/448 (42%) Gaps:120/448 (27%)


  Fly    86 NLRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRWKYV 150
            |:.::||:..:|..|...:.||::||.||||||..:...|||||...|.::::...:|:||:|: 
 Frog    75 NITVTLDNNNMWNEFYRCSTEMVLTKQGRRMFPYCRYWISGLDPYQKYILVMDISPMDNHRYKW- 138

  Fly   151 NGE-WVPGGKAEVPPSNPIYVHPESPNFGAHWMKEPISFAKVKLTNK-TNGNGQIMLNSLHKYEP 213
            ||: |..|||:|......:::|||||:.|.:||.:|:||.|:||||. .:..|.|:|:|:|:|.|
 Frog   139 NGKWWEAGGKSEPHVLGRVFIHPESPSTGQYWMHQPVSFYKLKLTNNILDQEGHIILHSMHRYLP 203

  Fly   214 RVHLVRVGSEQR-------HVVTYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAFLDAKERPDT 271
            |:|:|.......       .|.|:.||:|:|||||||||.::|.|||..|||||.|.:       
 Frog   204 RLHVVPANQSTEVIQLNGPDVHTFTFPQTEFIAVTAYQNFQITQLKIDCNPFAKGFRE------- 261

  Fly   272 LYPHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAESVGPSSGGSCDRYGR 336
                                   ......|:..|:|..      |....:|.||......:...|
 Frog   262 -----------------------GAMTGKPVKEAKSKN------SDQENDSQGPQPHNDSESILR 297

  Fly   337 SLSSRSVAPTRTTPYSRPRVVSGSGSNGSAGNASSTSPQPPSAPQTPTSLHSTSTGSVSTSVSSS 401
             |.....||..:...:.|...:......:..::..::|..|...              |..::|.
 Frog   298 -LRELFRAPENSDGETDPEAFNAEHDFFNCKDSRLSNPDTPRIQ--------------SDGLNSP 347

  Fly   402 SGGGIGSAPSTGCFSSSYAQSGFMSV---------------DASPTASVFSYPSSWQSNGNYWNA 451
            :..||||:||.   :||....|..::               ...||.::                
 Frog   348 AQTGIGSSPSV---ASSLDPKGQPNIVIKEEPVDDYDYDYGKEQPTGAI---------------- 393

  Fly   452 TSVPGPMPMNVCSGRNISSHNSPSPTNGSPSYTTSSPSYTI--HHLT-----PHSHQ 501
                           |:...:....|:   .|:.|...|.|  .|.:     |||.:
 Frog   394 ---------------NVKQESEEEETD---EYSNSDDEYPILERHFSQFRKQPHSER 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 TBOX 86..268 CDD:238106 82/191 (43%)
mgaXP_012824488.1 TBOX 75..262 CDD:238106 82/218 (38%)
DUF4801 996..1038 CDD:292677
DUF1103 2086..2282 CDD:115185
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1201455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.