DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: byn and eomes

Sequence 1:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_001122124.1 Gene:eomes XenbaseID:XB-GENE-479769 Length:667 Species:Xenopus tropicalis

Alignment Length:564 Identity:168/565 (30%)
Similarity:237/565 (42%) Gaps:139/565 (25%)


  Fly    29 AGGGA-----GS-------------GSPQHVTHNGHGHGHGLGGV-----AAVSGGGASVSGNGG 70
            |||.|     ||             ..||:  .:|:.:....|.:     .|.:|.|.|..|..|
 Frog   160 AGGAARYPPYGSMLPPAGFSPPVCPSRPQY--SSGYQYSQAPGTMYSPYPPAGTGSGLSALGLPG 222

  Fly    71 HRVVGGAGSPNELDRNLRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTV 135
                ||||.      ..::.|.:|.|||:|.....|||:||.||||||.:..:.:||:|.|.|.|
 Frog   223 ----GGAGV------RAQVFLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNITGLNPTAHYNV 277

  Fly   136 LLEFVQIDSHRWKYVNGEWVPGGKAE-VPPSNPIYVHPESPNFGAHWMKEPISFAKVKLTNKTNG 199
            .:|.|..|.:.|::..|:||..|||: ....|.:||||||||.|||||::.|||.|:||||....
 Frog   278 FVEVVLADPNHWRFQGGKWVTCGKADNNMQGNKVYVHPESPNTGAHWMRQEISFGKLKLTNNKGA 342

  Fly   200 NG----QIMLNSLHKYEPRVHLVRVG-------SEQRHVVTYPFPETQFIAVTAYQNEEVTSLKI 253
            |.    .|:|.|||||:||:|:|.|.       ::.....|:.||||||||||||||.::|.|||
 Frog   343 NNNSTQMIVLQSLHKYQPRLHIVEVSEDGVEDLNDSAKSQTFTFPETQFIAVTAYQNTDITQLKI 407

  Fly   254 KYNPFAKAFLDAKERPDTLYPHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVS 318
            .:|||||.|.|..:                   :.|||:.:....|.|....:||.:|       
 Frog   408 DHNPFAKGFRDNYD-------------------SMYTASESDRLTPSPADSPRSHQIV------- 446

  Fly   319 SAESVGPSSGGSCDRYGRSLSSRSVAPTRTTPYSRPRVVSGSG------SNGSAGNASSTSPQPP 377
                  |.:..|...:.:.....::.|.|.  ||..|.|..:.      :|....||      ||
 Frog   447 ------PGTRYSVQPFFQDQFVNNLPPARY--YSGERTVPQANGLLSPQTNDEVANA------PP 497

  Fly   378 S----APQTPTSLHSTSTGSVSTSVSSSS--GGGIGSAP-STGCFSSSYAQSGFMSVDASPTASV 435
            .    .|....:.:....|:..|..||.|  ..||.|.| .|....:.|..:.|.|:        
 Frog   498 QRWFVTPVQQAAANKLDMGAYETDYSSGSLLTYGIKSLPIQTSHPMAYYPDAAFASM-------- 554

  Fly   436 FSYPSSWQSNGNY----------WNATSVPGPMPMNVCSGRNISSHNSPS-----------PTNG 479
                :.|.|.|:.          |::.|.|.....::.....:....|.|           .:|.
 Frog   555 ----AGWGSRGSTYQRKMTTTLPWSSRSSPSGFSEDLLPKDKVKEEMSSSWVETPPSIKSLDSND 615

  Fly   480 SPSYTTS------SPSYTIHHLTPHSHQYNMAQTDIYGTGVGVG 517
            |..||.:      |||.:.:..:|.....::...|......|:|
 Frog   616 SGVYTGACKRRRLSPSTSSNENSPPIKCEDIGNEDYKDATKGLG 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 TBOX 86..268 CDD:238106 94/194 (48%)
eomesNP_001122124.1 TBOX 229..422 CDD:238106 94/212 (44%)
T-box_assoc 444..665 CDD:292794 47/250 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.