DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CCNA1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_003905.1 Gene:CCNA1 HGNCID:1577 Length:465 Species:Homo sapiens

Alignment Length:409 Identity:156/410 (38%)
Similarity:230/410 (56%) Gaps:71/410 (17%)


  Fly    53 NGNNNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYEDNNDTQVAPSGKSL 117
            :|:.|...||||    :.:.:..|.|..:.|               |.:|.|..:..        
Human   108 SGSENAFPPAGK----KALPDCGVQEPPKQG---------------FDIYMDELEQG-------- 145

  Fly   118 ASLVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQ--------SPMSVDRSILGVIQSSDI-SV 173
                |:::..|:.|...:::  |::|:..:. :|:.        |||.||.|:|.  ||.|| |:
Human   146 ----DRDSCSVREGMAFEDV--YEVDTGTLK-SDLHFLLDFNTVSPMLVDSSLLS--QSEDISSL 201

  Fly   174 GTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSI 238
            ||:.                    :.|.:|..:|.:|.||:|.:||||..||::|.||:..||:|
Human   202 GTDV--------------------INVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTI 246

  Fly   239 LIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEF 303
            |:||||||.|||||..|||||:|.:||||||.|:|:|.||||||||||.:|:||||||||||.||
Human   247 LVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEF 311

  Fly   304 VFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEG 368
            |::|||:|||.|:|:||.::||:|:|||..||...|:..|.....:..:.:.:..|::||||:|.
Human   312 VYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEA 376

  Fly   369 ETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKEL---NT 430
            :.:|:|||||:::|:..||.:.:....|...|...|.|.|.:   :|..|...||...::   ..
Human   377 DPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSE---IVPCLSELHKAYLDIPHRPQ 438

  Fly   431 QAMREKYNRDTYKKVAMME 449
            ||:||||....|..|::||
Human   439 QAIREKYKASKYLCVSLME 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 84/126 (67%)
Cyclin_C 334..450 CDD:281044 38/120 (32%)
CCNA1NP_003905.1 Cyclin_N2 71..>145 CDD:293109 12/56 (21%)
Cyclin_N 214..340 CDD:278560 84/126 (67%)
Cyclin_C 342..459 CDD:281044 38/120 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3202
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D520533at33208
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 1 1.000 T608785
orthoMCL 1 0.900 OOG5_126649
Panther 1 1.100 O PTHR10177
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.