DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CLN2

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_015067.1 Gene:CLN2 SGDID:S000006177 Length:545 Species:Saccharomyces cerevisiae

Alignment Length:196 Identity:45/197 (23%)
Similarity:80/197 (41%) Gaps:43/197 (22%)


  Fly   202 QYQMDILEYFRESEKKHRPKPLYMRRQKDISH-NMRSILIDWLVEVSEEYKLDTETLYLSVFYLD 265
            :|..:|.........|.:|.|..:.:|.:::. ..||.:|.:|.|:|...::.....:.||...|
Yeast    39 EYHQEISTNVIAQSCKFKPNPKLIDQQPEMNPVETRSNIITFLFELSVVTRVTNGIFFHSVRLYD 103

  Fly   266 RFLSQMAVVRSKLQLVGTAAMYIAAK---------YEEIYP--------------PEVGEFVFLT 307
            |:.|:..|:|.:.:||....:::|||         ...:.|              |.:.|.|...
Yeast   104 RYCSKRIVLRDQAKLVVATCLWLAAKTWGGCNHIINNVVIPTGGRFYGPNPRARIPRLSELVHYC 168

  Fly   308 DDS--YTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGET 370
            .|.  :.::..|:||:.||..|::::..|    .||.|             .|.:.|..||:.|.
Yeast   169 GDGQVFDESMFLQMERHILDTLNWNIYEP----MINDY-------------VLNVDENCLMQYEL 216

  Fly   371 Y 371
            |
Yeast   217 Y 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 34/152 (22%)
Cyclin_C 334..450 CDD:281044 10/39 (26%)
CLN2NP_015067.1 COG5024 33..524 CDD:227357 45/197 (23%)
Cyclin_N 43..194 CDD:278560 34/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96065650
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.